DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbce and mlt

DIOPT Version :9

Sequence 1:NP_610197.2 Gene:Tbce / 35532 FlyBaseID:FBgn0033055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001260853.1 Gene:mlt / 36072 FlyBaseID:FBgn0265512 Length:459 Species:Drosophila melanogaster


Alignment Length:428 Identity:93/428 - (21%)
Similarity:162/428 - (37%) Gaps:128/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSSQITELEPSFRQLKRINLRSC----G 221
            |:::...:.:|..|.||.:.:|.:..||||.|:|..|..:..|  .|:      |||:|.    .
  Fly    90 LDLAQNKLSDWSEVFSILEHMPRIEFLNLSKNQLASPIGTLPT--APT------INLKSLVLNGT 146

  Fly   222 FSDWKDVMHTALLWPNILSLGLQENSLGQLAEVDRTKIFKQLHELD------------------L 268
            :.||..|.......|.:..|.|..|:..|:. :|..:..::|.|.:                  |
  Fly   147 YLDWACVDTLLKNLPVLQELHLSLNNYRQVL-IDAEEAEQRLQETETPEETERRITKAHPALKTL 210

  Fly   269 HRTN--IMDFDQVTKLGNLTTLRLLNIMENGIEEIKLPDC--------DSQEKLNIFVSLEQLNL 323
            |.|.  :..:.::.:||.|..         .:|.:.|.||        :|.|....|.||..|||
  Fly   211 HFTGNPVEHWQEICRLGRLFP---------NLEALVLADCPIKSLQAEESSETHRYFPSLRLLNL 266

  Fly   324 LHNPIWNEADAFNELDKLPQLKRLSKTPH------LKSNFDEMFSKAVASIASLQFIN-KAEVTA 381
            ....:.:.| |.:||.|..:|:.| :..|      |:....|.....:|.:.:::.:| ..::::
  Fly   267 SSAQLDSWA-AIDELAKFSELRNL-RVKHWPLWESLECTEHERRQLLIARLPNVEMLNGGGKISS 329

  Fly   382 EQRRGAEYDIWKKYALDWMQATQGGTDSLREFCRRHRTYPLLVKKYGSPADFVPRSQ--AKQSNL 444
            ::|                      .||.|.|.|.:...|    :...||.:....|  .|...|
  Fly   330 DER----------------------VDSERAFVRYYMDKP----EEERPARYQELLQIHGKLDPL 368

  Fly   445 INVSIRHQLTGETWEKKVPRMITVQ------------TLQGLVMKRFRLSGDVP---QLCYVD-- 492
            :|||::.       :|:|..:.|..            |:..|.:|..:|.|..|   :|.|:|  
  Fly   369 VNVSLKP-------DKRVKVLFTYNDVSESRFVDIYLTVNDLKVKLEKLVGLAPNKMRLYYLDQD 426

  Fly   493 --------ALHPDLVVPLDNNAKTLDFYSVQEHDTVLV 522
                    ..:|:         |.|..|::|..|.:::
  Fly   427 YKEFGPEEMRYPN---------KQLYSYNIQSGDEIII 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbceNP_610197.2 CAP_GLY 14..79 CDD:214997
LRR_RI <148..268 CDD:330982 30/128 (23%)
leucine-rich repeat 158..183 CDD:275380 5/21 (24%)
leucine-rich repeat 184..211 CDD:275380 9/26 (35%)
leucine-rich repeat 212..238 CDD:275380 8/29 (28%)
leucine-rich repeat 239..262 CDD:275380 5/22 (23%)
leucine-rich repeat 263..287 CDD:275380 8/43 (19%)
leucine-rich repeat 288..317 CDD:275380 7/36 (19%)
leucine-rich repeat 318..343 CDD:275380 9/24 (38%)
mltNP_001260853.1 LRR <46..>177 CDD:227223 27/94 (29%)
LRR_RI 57..>276 CDD:238064 49/204 (24%)
leucine-rich repeat 87..112 CDD:275380 5/21 (24%)
leucine-rich repeat 113..137 CDD:275380 9/31 (29%)
leucine-rich repeat 138..162 CDD:275380 5/23 (22%)
leucine-rich repeat 207..232 CDD:275380 6/33 (18%)
leucine-rich repeat 233..260 CDD:275380 7/26 (27%)
leucine-rich repeat 261..285 CDD:275380 9/24 (38%)
UBQ 379..456 CDD:294102 17/86 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15140
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.