DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbce and Tbcel

DIOPT Version :9

Sequence 1:NP_610197.2 Gene:Tbce / 35532 FlyBaseID:FBgn0033055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001344585.2 Gene:Tbcel / 272589 MGIID:1925543 Length:424 Species:Mus musculus


Alignment Length:406 Identity:105/406 - (25%)
Similarity:171/406 - (42%) Gaps:73/406 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VNAAGYLKEL----THLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSSQITE-- 204
            :..||..:|:    .|::.|::|...:.:|..|:.|...:|.|..||||||    |.|..:.|  
Mouse    60 ITCAGDEREIAAFCAHVSELDLSDNKLQDWHEVSKIVSNVPQLEFLNLSSN----PLSLSVLERT 120

  Fly   205 LEPSFRQLKRINLRSCGFSDWKDVMHTALL-WPNILSLGLQENSLGQLAEVDRTKI----FKQLH 264
            ...||..::::.|.:...| |:.| ||.|. .|.:..|.|   .|.....|....:    .|.||
Mouse   121 CAGSFSGVRKLVLNNSKAS-WETV-HTILQELPELEELFL---CLNDYETVSCPSVCCHSLKLLH 180

  Fly   265 ELDLHRTNIMDFDQVTKLG----NLTTLRLLNIMENGIEEIKLPDCDSQEKLNIFVSLEQLNLLH 325
            ..|   .|:.|:.::.|||    :|.||.|.|...|.|||    ..||..:|  |.:|..::|..
Mouse   181 ITD---NNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEE----PADSLARL--FPNLRSISLHK 236

  Fly   326 NPI--WNEADAFNELDKLPQLKRLSKTPHLKS-NFDEMFSKAVASIASLQFINKAEVTAEQRRGA 387
            :.:  |.:.|..|...||.:: ||...|.|:. ..:|.....||.:.|:..:|.:.||..:|..:
Mouse   237 SGLQSWEDIDKLNSFPKLEEV-RLLGIPLLQPYTTEERRKLVVARLPSVSKLNGSVVTDGEREDS 300

  Fly   388 EYDIWKKYALDWMQATQGGTDSLREFCRRHRTYPLLVKKYG-----SPADFVPRSQAK-----QS 442
            | ..:.:|.:|..|         .|...|   |..|:.|||     :..|..|:|.||     ..
Mouse   301 E-RFFIRYYVDVPQ---------EEVPFR---YHELITKYGKLEPLAEVDLRPQSSAKVEVHFND 352

  Fly   443 NLINVSIRHQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVDALHPDLVVPLDNNAK 507
            .:..:|||...|....:|::..::.:.|...|             |.|.|...|.....:..:::
Mouse   353 QVEEMSIRLDQTVAELKKQLKTLVQLPTSSML-------------LYYFDHEAPFGPEEMKYSSR 404

  Fly   508 TLDFYSVQEHDTVLVQ 523
            .|..:.:::.|.:.|:
Mouse   405 ALHSFGIRDGDKIFVE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbceNP_610197.2 CAP_GLY 14..79 CDD:214997
LRR_RI <148..268 CDD:330982 37/130 (28%)
leucine-rich repeat 158..183 CDD:275380 5/24 (21%)
leucine-rich repeat 184..211 CDD:275380 12/28 (43%)
leucine-rich repeat 212..238 CDD:275380 8/26 (31%)
leucine-rich repeat 239..262 CDD:275380 4/26 (15%)
leucine-rich repeat 263..287 CDD:275380 9/27 (33%)
leucine-rich repeat 288..317 CDD:275380 11/28 (39%)
leucine-rich repeat 318..343 CDD:275380 7/26 (27%)
TbcelNP_001344585.2 PPP1R42 <50..113 CDD:411060 18/56 (32%)
leucine-rich repeat 52..74 CDD:275380 3/13 (23%)
LRR 1 73..98 6/24 (25%)
leucine-rich repeat 78..101 CDD:275378 5/22 (23%)
LRR 2 99..123 11/27 (41%)
leucine-rich repeat 102..175 CDD:275378 24/81 (30%)
LRR 3 124..147 8/24 (33%)
leucine-rich repeat 129..148 CDD:275380 6/20 (30%)
LRR 4 152..173 4/23 (17%)
LRR 5 175..196 7/23 (30%)
leucine-rich repeat 176..201 CDD:275378 9/27 (33%)
LRR_9 <191..304 CDD:405295 36/120 (30%)
LRR 6 201..222 10/24 (42%)
leucine-rich repeat 202..228 CDD:275378 13/31 (42%)
LRR 7 228..249 4/20 (20%)
Ubl_TBCEL 337..422 CDD:340565 19/97 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.