DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbce and TBCEL

DIOPT Version :9

Sequence 1:NP_610197.2 Gene:Tbce / 35532 FlyBaseID:FBgn0033055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001123519.1 Gene:TBCEL / 219899 HGNCID:28115 Length:424 Species:Homo sapiens


Alignment Length:405 Identity:104/405 - (25%)
Similarity:171/405 - (42%) Gaps:71/405 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 VNAAGYLKEL----THLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSSQITE-- 204
            :..||..||:    .|::.|::|...:.:|..|:.|...:|.|..||||||    |.:..:.|  
Human    60 ITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSN----PLNLSVLERT 120

  Fly   205 LEPSFRQLKRINLRSCGFSDWKDVMHTALLWPNILSLGLQENSLGQLAEVDRTKI----FKQLHE 265
            ...||..::::.|.:...| |:.|.......|::..|.|   .|.....|....|    .|.||.
Human   121 CAGSFSGVRKLVLNNSKAS-WETVHMILQELPDLEELFL---CLNDYETVSCPSICCHSLKLLHI 181

  Fly   266 LDLHRTNIMDFDQVTKLG----NLTTLRLLNIMENGIEEIKLPDCDSQEKLNIFVSLEQLNLLHN 326
            .|   .|:.|:.::.|||    :|.||.|.|...|.|||   || ||..:|  |.:|..::|..:
Human   182 TD---NNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEE---PD-DSLARL--FPNLRSISLHKS 237

  Fly   327 PI--WNEADAFNELDKLPQLKRLSKTPHLKS-NFDEMFSKAVASIASLQFINKAEVTAEQRRGAE 388
            .:  |.:.|..|...||.:: ||...|.|:. ..:|.....:|.:.|:..:|.:.||..:|..:|
Human   238 GLQSWEDIDKLNSFPKLEEV-RLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSE 301

  Fly   389 YDIWKKYALDWMQATQGGTDSLREFCRRHRTYPLLVKKYG-----SPADFVPRSQAK-----QSN 443
             ..:.:|.:|..|         .|...|   |..|:.|||     :..|..|:|.||     ...
Human   302 -RFFIRYYVDVPQ---------EEVPFR---YHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQ 353

  Fly   444 LINVSIRHQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVDALHPDLVVPLDNNAKT 508
            :..:|||...|....:|::..::.:.|...|             |.|.|...|.....:..:::.
Human   354 VEEMSIRLDQTVAELKKQLKTLVQLPTSNML-------------LYYFDHEAPFGPEEMKYSSRA 405

  Fly   509 LDFYSVQEHDTVLVQ 523
            |..:.:::.|.:.|:
Human   406 LHSFGIRDGDKIYVE 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbceNP_610197.2 CAP_GLY 14..79 CDD:214997
LRR_RI <148..268 CDD:330982 35/129 (27%)
leucine-rich repeat 158..183 CDD:275380 5/24 (21%)
leucine-rich repeat 184..211 CDD:275380 11/28 (39%)
leucine-rich repeat 212..238 CDD:275380 5/25 (20%)
leucine-rich repeat 239..262 CDD:275380 5/26 (19%)
leucine-rich repeat 263..287 CDD:275380 9/27 (33%)
leucine-rich repeat 288..317 CDD:275380 13/28 (46%)
leucine-rich repeat 318..343 CDD:275380 7/26 (27%)
TBCELNP_001123519.1 LRR <47..>225 CDD:227223 54/179 (30%)
leucine-rich repeat 52..75 CDD:275380 4/14 (29%)
LRR 1 73..98 6/24 (25%)
leucine-rich repeat 76..101 CDD:275380 5/24 (21%)
LRR 2 99..123 10/27 (37%)
leucine-rich repeat 102..130 CDD:275380 11/31 (35%)
LRR 3 124..147 6/23 (26%)
leucine-rich repeat 131..152 CDD:275380 4/21 (19%)
LRR 4 150..172 5/24 (21%)
leucine-rich repeat 153..175 CDD:275380 5/24 (21%)
LRR 5 173..197 8/26 (31%)
leucine-rich repeat 176..201 CDD:275380 9/27 (33%)
LRR_9 <191..304 CDD:317038 37/120 (31%)
LRR 6 199..224 13/28 (46%)
leucine-rich repeat 202..225 CDD:275380 13/26 (50%)
LRR 7 226..250 5/23 (22%)
leucine-rich repeat 229..253 CDD:275380 5/23 (22%)
UBQ 345..419 CDD:320785 14/86 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.