DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbce and coel-1

DIOPT Version :9

Sequence 1:NP_610197.2 Gene:Tbce / 35532 FlyBaseID:FBgn0033055 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_741764.1 Gene:coel-1 / 180700 WormBaseID:WBGene00016866 Length:432 Species:Caenorhabditis elegans


Alignment Length:508 Identity:107/508 - (21%)
Similarity:189/508 - (37%) Gaps:166/508 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 CATLEDAARERYLNYDSSNVDESLI----------REAQASLQASLFEVVGMDKIARKQSKFEQL 136
            |:||..:..::||:.|...|.:.:.          ..:|.:|:..:...:.:|.|...:......
 Worm     5 CSTLVRSLEQKYLDDDEDIVQDIIFTGFTGCSPCKMASQRALELLVLNNMNIDTIGDSEKLATLA 69

  Fly   137 EEVSVDQTPVN-------AAGYLKELTHLTTLNVS-----------------HTLIWN-----WE 172
            ..||......|       .|..||.|.||..||:.                 ||:|.|     ::
 Worm    70 SHVSEADLGWNQISKWSDIACILKNLPHLRVLNIGHNPLNPVIDHELPVSTLHTIILNGTHLPFK 134

  Fly   173 IVASIAQQLPSLTNLNLSSNRLVLPTSSQITELEPSFRQLKRINLRSCGFSDWKDVMHTALLWPN 237
            .:.|....||.:|.|::|.|:........    ||....::.::|..|||..|..||:....:||
 Worm   135 TLQSFLSVLPKVTELHMSDNQFNDDDDCD----EPISTTVRTVHLNRCGFLKWSSVMNVVKRFPN 195

  Fly   238 ILSLGLQENSLGQLAEVDRTKIFKQL---HELDLHRTNIMDFDQVTKLGNLTTLRLLNIMENGIE 299
            :.|:.:.||   .|.:|...|.|:||   :.|:|.:|:|..:|.:.:|..:|:          |.
 Worm   196 VCSVFVCEN---PLKDVTHCKHFEQLPFWNFLNLAKTSIDSWDSLDQLNRMTS----------IS 247

  Fly   300 EIKLPDCDSQEKLNIFVSLEQLNLLHNPIWNEADAFNELDKLPQLKRLSKTPHLKSNFDEMFSKA 364
            ::::|        ||            |:         ||.|...:||    ||          .
 Worm   248 DLRVP--------NI------------PL---------LDALTNEERL----HL----------I 269

  Fly   365 VASIASLQFINKAEVTAEQRRGAEYDIWKKYALDWMQATQGGTDSLREFCRRHRTYPLLVKKYGS 429
            :..:..|:.:|.:::::|||..:|....:.|               :|...:...|..|:.|:|:
 Worm   270 IGRLHHLRVLNGSKISSEQREQSERFFIRYY---------------QEQKEKPLQYKTLIDKHGN 319

  Fly   430 -----PADFVPRSQAKQSNLINVSIRHQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLC 489
                 ..|..|:.:|....|..            ||:|.:.||: :|:..|            |.
 Worm   320 LEKLVTIDLTPKKEAVVKILCE------------EKEVNQEITI-SLEPTV------------LD 359

  Fly   490 YVDALHPDLVVP--------LDNNAKTLDF-----------YSVQEHDTVLVQ 523
            ::..|.|.:.|.        |..:.:|.||           :.:::.|:.|||
 Worm   360 FMKILDPKVGVKFTRMKLFLLREDGRTDDFSSSDYNMPLHYFKIEDGDSFLVQ 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbceNP_610197.2 CAP_GLY 14..79 CDD:214997
LRR_RI <148..268 CDD:330982 40/144 (28%)
leucine-rich repeat 158..183 CDD:275380 9/46 (20%)
leucine-rich repeat 184..211 CDD:275380 6/26 (23%)
leucine-rich repeat 212..238 CDD:275380 8/25 (32%)
leucine-rich repeat 239..262 CDD:275380 7/22 (32%)
leucine-rich repeat 263..287 CDD:275380 7/26 (27%)
leucine-rich repeat 288..317 CDD:275380 4/28 (14%)
leucine-rich repeat 318..343 CDD:275380 4/24 (17%)
coel-1NP_741764.1 leucine-rich repeat 46..64 CDD:275378 3/17 (18%)
leucine-rich repeat 65..97 CDD:275378 7/31 (23%)
leucine-rich repeat 98..117 CDD:275378 3/18 (17%)
leucine-rich repeat 121..145 CDD:275378 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.