DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tbce and tbcelb

DIOPT Version :9

Sequence 1:NP_610197.2 Gene:Tbce / 35532 FlyBaseID:FBgn0033055 Length:523 Species:Drosophila melanogaster
Sequence 2:XP_002662215.1 Gene:tbcelb / 100332392 ZFINID:ZDB-GENE-100921-13 Length:428 Species:Danio rerio


Alignment Length:413 Identity:106/413 - (25%)
Similarity:181/413 - (43%) Gaps:77/413 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 VDQTPVNAAGYLKEL----THLTTLNVSHTLIWNWEIVASIAQQLPSLTNLNLSSNRLVLPTSSQ 201
            :|...:..||..:|:    .|:..|::||..:.:|..::.|...:|:|..||||.|.|      .
Zfish    57 LDGCGITEAGDEEEVATFCAHVVELDLSHNQLKDWGEISKILSNIPNLDFLNLSMNPL------H 115

  Fly   202 ITELEP----SFRQLKRINLRSCGFSDWKDVMHTALL-WPNILSLGLQENSLGQLAEVDRTKI-- 259
            .:.|||    :|..|:|:.|.:...: | |::||... .|::..|.|   .|.:...|:.:.:  
Zfish   116 GSSLEPCLAEAFSGLRRLVLNNTHVT-W-DMVHTLTREIPDLEELFL---CLNEYESVNASSMPC 175

  Fly   260 --FKQLHELDLHRTNIMDFDQVTKLG----NLTTLRLLNIMENGIEEIKLPDCDSQEKLNIFVSL 318
              .:.||..|   ..:.|:.:|.|||    .|.:|.|.|   |.:..|..|: ||..:|  |.:|
Zfish   176 PSLRLLHITD---NQLQDWVEVRKLGLMYPGLVSLILSN---NSLSSIHEPE-DSLHRL--FPNL 231

  Fly   319 EQLNLLHN---PIWNEADAFNELDKLPQLKRLSKTPHLKSNFD-EMFSKAVASIASLQFINKAEV 379
            ..:| |||   ..|.:.:..|...||.:: |:...|.|:...| |.....||.:..:..:|.:.|
Zfish   232 RSIN-LHNSGLSRWEDVEKLNFFPKLQEV-RVMGIPLLQPYTDQERRCLMVAQLPHVTVLNGSVV 294

  Fly   380 TAEQRRGAEYDIWKKYALDWMQATQGGTDSLREFCRRHRTYPLLVKKYG-----SPADFVPRSQA 439
            |..:|..|| ..:.:|.||..:      |.|.:      .|..||.:||     :..|..|.|. 
Zfish   295 TDGEREDAE-RFFIRYHLDCPE------DELPQ------RYHTLVARYGRLAPLAEVDLRPLSH- 345

  Fly   440 KQSNLINVSIRHQLTGETWEKKVPRMITVQTLQGLVMKRFRLSGDVPQLCYVD-----ALHPDLV 499
                 :.|.:|.....::.|.::.:  ||..|:..:....:|..:..::.|:|     ||.|.  
Zfish   346 -----VQVQVRFGDQAKSLELRLDQ--TVADLKKQLKTVVQLPPNKIRVYYIDRQLGYALEPQ-- 401

  Fly   500 VPLDNNAKTLDFYSVQEHDTVLV 522
             .:...|:.|..||:::.|.::|
Zfish   402 -EMKYGARALHSYSIRDGDEIMV 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TbceNP_610197.2 CAP_GLY 14..79 CDD:214997
LRR_RI <148..268 CDD:330982 35/132 (27%)
leucine-rich repeat 158..183 CDD:275380 5/24 (21%)
leucine-rich repeat 184..211 CDD:275380 11/30 (37%)
leucine-rich repeat 212..238 CDD:275380 8/26 (31%)
leucine-rich repeat 239..262 CDD:275380 4/26 (15%)
leucine-rich repeat 263..287 CDD:275380 9/27 (33%)
leucine-rich repeat 288..317 CDD:275380 10/28 (36%)
leucine-rich repeat 318..343 CDD:275380 9/27 (33%)
tbcelbXP_002662215.1 LRR <47..>218 CDD:227223 47/177 (27%)
leucine-rich repeat 54..77 CDD:275380 4/19 (21%)
leucine-rich repeat 78..103 CDD:275380 5/24 (21%)
LRR_RI <80..214 CDD:238064 42/150 (28%)
leucine-rich repeat 104..129 CDD:275380 11/30 (37%)
leucine-rich repeat 130..154 CDD:275380 7/25 (28%)
leucine-rich repeat 155..177 CDD:275380 4/24 (17%)
LRR_8 176..241 CDD:290566 24/74 (32%)
leucine-rich repeat 178..203 CDD:275380 8/27 (30%)
leucine-rich repeat 204..227 CDD:275380 9/26 (35%)
UBQ 346..426 CDD:214563 18/83 (22%)
UBQ 351..426 CDD:176352 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2217
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.