DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14591 and TMEM164

DIOPT Version :9

Sequence 1:NP_001188864.1 Gene:CG14591 / 35531 FlyBaseID:FBgn0033054 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001340778.1 Gene:TMEM164 / 84187 HGNCID:26217 Length:297 Species:Homo sapiens


Alignment Length:265 Identity:105/265 - (39%)
Similarity:157/265 - (59%) Gaps:15/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DWAVGGISDEIPRTTGPECINYMTDRRRWLE-----TILLSALFIFIMHRSWQRLAPIKLPP--- 60
            ||..||:........||:|..:::.::|.||     |:.|..:.:.:.|...|.....:..|   
Human    11 DWLYGGVDPSFAGNGGPDCAAFLSWQQRLLESVVVLTLALLEILVALRHILRQTKEDGRGSPGSQ 75

  Fly    61 PHEI-QKP----HSPTRLFLLIALSMIFGIEMGFKLSGQSMIFALNPCHVQSCLQIYLLAAKPTK 120
            |.:: |:|    .|.::..||:||.:.||:|:|||.:.:::|:.|||||:.:.:.|:|||..|.:
Human    76 PEQVTQRPEEGKESLSKNLLLVALCLTFGVEVGFKFATKTVIYLLNPCHLVTMMHIFLLACPPCR 140

  Fly   121 TTTALFRIQMSNLNGPFLAFLFPEVEGRTYPFEQATYWIQHALLYIIPIYII-RSGAYTVEDLSE 184
            ....:|::||..|||..||.|||.|..|..|||...|:|||.:||::|||:: :.||||.|.||.
Human   141 GAIVVFKLQMHMLNGALLALLFPVVNTRLLPFELEIYYIQHVMLYVVPIYLLWKGGAYTPEPLSS 205

  Fly   185 FHWSHIGTAFMLFYHFILLSPLSIFTGINLDHMLCAAMSDPFQGSNYRIFACCHQALLCPLLSKG 249
            |.|:.:.|..|.||||.:|..|.:.|.:||::|||.|:||||.|..|||:|..||.|:.....| 
Human   206 FRWALLSTGLMFFYHFSVLQILGLVTEVNLNNMLCPAISDPFYGPWYRIWASGHQTLMTMTHGK- 269

  Fly   250 TVVLF 254
            .|:||
Human   270 LVILF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14591NP_001188864.1 TMEM164 3..252 CDD:291474 102/261 (39%)
TMEM164NP_001340778.1 TMEM164 10..273 CDD:405494 103/262 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..85 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142069
Domainoid 1 1.000 192 1.000 Domainoid score I3234
eggNOG 1 0.900 - - E1_28PNH
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12985
Inparanoid 1 1.050 193 1.000 Inparanoid score I3857
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58735
OrthoDB 1 1.010 - - D1509337at2759
OrthoFinder 1 1.000 - - FOG0006231
OrthoInspector 1 1.000 - - oto89307
orthoMCL 1 0.900 - - OOG6_105531
Panther 1 1.100 - - LDO PTHR20948
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2989
SonicParanoid 1 1.000 - - X4512
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.