DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCAP and scp1

DIOPT Version :9

Sequence 1:NP_788277.1 Gene:SCAP / 35529 FlyBaseID:FBgn0033052 Length:1276 Species:Drosophila melanogaster
Sequence 2:NP_596673.1 Gene:scp1 / 2541065 PomBaseID:SPBC3B9.15c Length:1086 Species:Schizosaccharomyces pombe


Alignment Length:322 Identity:77/322 - (23%)
Similarity:134/322 - (41%) Gaps:68/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 QIFPEYG---------CLLLSPANLWTQNSQNFTRDTNILNTIFQYHNLQKSKVSAAEMLFGLP- 292
            |...|||         |:.:||                    |.:|:. :...|:......||| 
pombe   115 QYLAEYGYPCIRDEKSCVTISP--------------------IPKYYG-KVDPVAQYSYTKGLPE 158

  Fly   293 --------MQDT---GFKRYPLRARSRIIQYALTLFLKHNDMEYLDTLKEKLLRHYPPLPLASAS 346
                    ..||   ||        ..:..:.:|.|||...::....:.:|.:...|.| .||..
pombe   159 NEREVNKLRNDTIAEGF--------DSLSAFVITYFLKPEQVDTFHVVLKKFISETPNL-YASLL 214

  Fly   347 AEEPTTI-------TYIFYPGEYRMWELVPYTVAFMLVFAYVYFSVRKIDVFRSRFLLALCSVIT 404
            ...|||:       |.|     ||.:..|.:.|.   :|||:|.|:.::...|::|.|.....|.
pombe   215 DTSPTTVVARIPDLTVI-----YRWYLWVGFGVG---LFAYLYLSLVRLHDIRAKFGLTATIFIQ 271

  Fly   405 TAGSLAMSLGLCFFFGLTISLQSKDIFPYLVILVGLENSLVITKSVVSMDETFDVKIRVAQALSK 469
            :..:...:..|.:||..|..:....:..|::|.:.:|||..:.::|::..:|..|..|:.:..|.
pombe   272 SGTAYFSTCSLLYFFERTGPICPWPMAYYIIIFMDIENSFRLLRAVIASPQTKRVPSRIMEGFSS 336

  Fly   470 EGWHISKTLLTEITILTIGLATFV-PVIQEFCIFAIVGLLSDFMLQMLLFSTILAMNIKRTE 530
            .......:||.::..|.: |:.|| |::||||:|.....:..|:|....|..:|:::|:|.|
pombe   337 TIIASFSSLLKKLLTLFV-LSFFVYPLVQEFCLFLACSFVVSFLLHGSFFLAVLSVDIRRLE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCAPNP_788277.1 Sterol-sensing 390..542 CDD:289145 37/142 (26%)
WD40 <878..1227 CDD:225201
WD40 878..1185 CDD:295369
WD40 repeat 887..942 CDD:293791
WD40 repeat 945..983 CDD:293791
WD40 repeat 989..1070 CDD:293791
WD40 repeat 1079..1114 CDD:293791
WD40 repeat 1120..1157 CDD:293791
WD40 repeat 1162..1196 CDD:293791
WD40 repeat 1201..1233 CDD:293791
scp1NP_596673.1 TDT <178..>305 CDD:296283 33/135 (24%)
Sterol-sensing 257..410 CDD:289145 37/142 (26%)
WD40 repeat 598..634 CDD:293791
WD40 repeat 642..675 CDD:293791
WD40 repeat 685..717 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3151
eggNOG 1 0.900 - - E1_KOG1933
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006370
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46378
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3741
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.