DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and CASP6

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001217.2 Gene:CASP6 / 839 HGNCID:1507 Length:293 Species:Homo sapiens


Alignment Length:265 Identity:75/265 - (28%)
Similarity:106/265 - (40%) Gaps:62/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 PARVY-----------IFNHERFDNKNEF-------RKGSAQDVKVLRATFEQLKCKVEVITDAT 358
            ||..|           |||||||     |       |:|:..|...|...|..|..:|:...|..
Human    33 PAEKYKMDHRRRGIALIFNHERF-----FWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLK 92

  Fly   359 LVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIA--AKDDDYSLDDDVVFPILRNRTLKDKP 421
            ...:...:..:.|....|....|.|.||||..:...|  ||.:..:|..  :|...:..:|..||
Human    93 AEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTG--LFKGDKCHSLVGKP 155

  Fly   422 KLIFVQACKG-------------DCQLGGFMT-----DAAQ----PNGSPNEILKCYSTYEGFVS 464
            |:..:|||:|             |.|.....|     |||.    |.|:  :.|.|||..||:.|
Human   156 KIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGA--DFLMCYSVAEGYYS 218

  Fly   465 FR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKD----------RQIPSVTSTLT 518
            .| |.:|:.:||.|||.|.:.|.:.:...::..|.:.|..:..|          :|:|...|.||
Human   219 HRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLT 283

  Fly   519 SKYVF 523
            .|..|
Human   284 KKLHF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 74/263 (28%)
CASP6NP_001217.2 CASc 37..290 CDD:214521 73/261 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.