DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and CASP5

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001129584.1 Gene:CASP5 / 838 HGNCID:1506 Length:447 Species:Homo sapiens


Alignment Length:241 Identity:59/241 - (24%)
Similarity:102/241 - (42%) Gaps:40/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTK-DFEDKSAL 380
            |..:.:||:. ..|.|:..|:..::...:.|...|....:.|...::..:|....: :.:...:.
Human   210 IICNTKFDHL-PARNGAHYDIVGMKRLLQGLGYTVVDEKNLTARDMESVLRAFAARPEHKSSDST 273

  Fly   381 VLVILSH-------GTRHDQIAAKDDDYSLDDDVVFPILRNR---TLKDKPKLIFVQACKGDCQL 435
            .||::||       ||.|.:   |..|..| .|.:|.|..||   :||||||:|.||||:|:...
Human   274 FLVLMSHGILEGICGTAHKK---KKPDVLL-YDTIFQIFNNRNCLSLKDKPKVIIVQACRGEKHG 334

  Fly   436 GGFMTDA----------AQPNGSPNEILK----------CYSTYEGFVSFRTED-GTPFIQTLCE 479
            ..::.|:          :..|...:.:.|          |.||... ||:|... |:.||..|..
Human   335 ELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFIAFCSSTPHN-VSWRDRTRGSIFITELIT 398

  Fly   480 ALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSV-TSTLTSK-YVF 523
            ...:......:..|...|::..::.....|:|:: .:|||.. |:|
Human   399 CFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLF 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 58/239 (24%)
CASP5NP_001129584.1 DD 76..155 CDD:301326
CASc 196..445 CDD:214521 59/241 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.