DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and CASP4

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001216.1 Gene:CASP4 / 837 HGNCID:1505 Length:377 Species:Homo sapiens


Alignment Length:334 Identity:75/334 - (22%)
Similarity:123/334 - (36%) Gaps:98/334 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 TKPKVTAVAQSQD------AQGTISTSLGISKSSLTKN-------------------KLKPARVY 316
            |:.||..:|.|..      .|..:.|...|.:.|..|.                   ||.|    
Human    50 TEDKVRVMADSMQEKQRMAGQMLLQTFFNIDQISPNKKAHPNMEAGPPESGESTDALKLCP---- 110

  Fly   317 IFNHERF-----------------DNK---------NEF-----RKGSAQDVKVLRATFEQLKCK 350
               ||.|                 :|:         .||     |.|:..|:..::...|.|...
Human   111 ---HEEFLRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDITGMKELLEGLDYS 172

  Fly   351 VEVITDATLVTIKKTVRMLQTK-DFEDKSALVLVILSH-------GTRHDQIAAKDDDYSLDDDV 407
            |:|..:.|...::..:|...|: :.:...:..||::||       ||.||:   |..|..| .|.
Human   173 VDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVHDE---KKPDVLL-YDT 233

  Fly   408 VFPILRNR---TLKDKPKLIFVQACKGDCQLGGFMTDA------AQPNGSPN-EILKCYSTY--E 460
            :|.|..||   :||||||:|.||||:|..:...::.|:      |....|.| |....|.|:  :
Human   234 IFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSSENLEEDAVYKTHVEK 298

  Fly   461 GFVSFRTED-----------GTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVT 514
            .|::|.:..           |:.||..|.....:......::.:...|:|..:......|:|::.
Human   299 DFIAFCSSTPHNVSWRDSTMGSIFITQLITCFQKYSWCCHLEEVFRKVQQSFETPRAKAQMPTIE 363

  Fly   515 STLTSKYVF 523
            ....::|.:
Human   364 RLSMTRYFY 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 63/273 (23%)
CASP4NP_001216.1 Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 1..59 3/8 (38%)
CARD_CASP1-like 5..81 CDD:260036 8/30 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 1/19 (5%)
CASc 126..375 CDD:214521 59/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.