DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp6b.1

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_005164109.1 Gene:casp6b.1 / 791531 ZFINID:ZDB-GENE-041010-48 Length:279 Species:Danio rerio


Alignment Length:246 Identity:68/246 - (27%)
Similarity:107/246 - (43%) Gaps:49/246 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 IFNHERFDNK--NEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379
            |||.::||.|  .:.|.|:.:|...|.:.|::|..:|:...|.:...:...::.....|..|...
Zfish    41 IFNQKQFDWKLGLKTRNGTDKDRDDLVSRFQELNFEVKAYNDYSRDDVLLKIQEASAADHVDADC 105

  Fly   380 LVLVILSHGTRHDQIAAKDDD--YSLDDDVVFPILRN-------RTLKDKPKLIFVQACKGDCQL 435
            .|.:.||||         :|.  |:.|..:..|.:.:       |:|..|||:...|||:|| :|
Zfish   106 FVCIFLSHG---------EDGHVYANDKKIEIPEITDLFKGDKCRSLVGKPKIFIWQACRGD-KL 160

  Fly   436 GGFMTDAA---------------QPNGSPNEILKCYSTYEGFVSFRTE-DGTPFIQTLCEALNRS 484
            ...:|:.:               .|.|:  :.:.||||.|||.|||.. :|:.:||.|||.|.|.
Zfish   161 DDAVTEMSVEDVEMAVDAGVLYTLPAGA--DFIMCYSTAEGFCSFREPLNGSWYIQDLCEILGRY 223

  Fly   485 GKTSDIDTIMMNVRQVVKMQS----------KDRQIPSVTSTLTSKYVFGD 525
            ........|:..|...|.::|          ..:|:|...|.||.:..|.|
Zfish   224 HSELQFTDILTLVNMKVSLRSVPNCRNRAAIGKKQMPCFASMLTKRLFFRD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 66/242 (27%)
casp6b.1XP_005164109.1 CASc 29..272 CDD:237997 66/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.