DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and XB5812047

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_031753853.1 Gene:XB5812047 / 733553 XenbaseID:XB-GENE-5812048 Length:244 Species:Xenopus tropicalis


Alignment Length:224 Identity:63/224 - (28%)
Similarity:101/224 - (45%) Gaps:43/224 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIK----KTVRMLQTKDFEDKSALVLVILSHGTR 390
            |||..:||..|.....:|..||.:..|.:...||    |..:|.|.:.|      :.::.|||..
 Frog    31 RKGVKRDVNRLFKVLSRLGYKVSLHMDVSAKEIKDIYQKESKMPQGESF------ISILSSHGNE 89

  Fly   391 HDQIAAKDDDYS----LDD--DVVFPILRNRT--LKDKPKLIFVQACKGD-CQLGGFM------- 439
                ....|.|.    |.|  |::.|   |.:  |...|||.|||||:|: ...|.|:       
 Frog    90 ----GLIYDFYGTPVLLRDLYDILAP---NNSPLLAGVPKLFFVQACRGEQFDEGVFLETDGDTC 147

  Fly   440 -TDAAQPN-GSPNEILKCYSTYEGFVSFRTEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVV- 501
             |||...: ..|.:.:..:::.||.|:|:...|:.|:||||..|....:..:::.|:..:..:| 
 Frog   148 ATDAFSLSLNLPRDSVLMFASSEGHVAFQNPGGSVFLQTLCNLLEGEERNLELNRILTRLAHMVA 212

  Fly   502 -KMQSKD-----RQIPSVTSTLTSK-YVF 523
             ..||:.     :::|..|:.||.: |.|
 Frog   213 YTFQSQGQYGGFKEMPCYTTNLTRELYPF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 62/222 (28%)
XB5812047XP_031753853.1 CASc 1..239 CDD:412128 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.