DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp2

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_038964243.1 Gene:Casp2 / 64314 RGDID:69274 Length:470 Species:Rattus norvegicus


Alignment Length:258 Identity:55/258 - (21%)
Similarity:96/258 - (37%) Gaps:66/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 EFRKGSAQDVKVLRATFEQLKCKVEVITDATL-------------------VTIKKTVRMLQTKD 373
            |||.|...|...|...|:.|...|.|:.|.|.                   ...:|.....|...
  Rat   217 EFRSGGDVDHTTLVTLFKLLGYNVHVLYDQTAQFHRFQLYSGIYKKYPKGQEMQEKLQNFAQLPA 281

  Fly   374 FEDKSALVLVILSHGTRHDQIAAKDDDYSLDDDV-----VFPILRNR---TLKDKPKLIFVQACK 430
            .....:.::.:||||       .:...|.:|..:     ||.:..|.   :|::|||:.|:|||:
  Rat   282 HRVTDSCIVALLSHG-------VEGGIYGVDGKLLQLQEVFRLFDNANCPSLQNKPKMFFIQACR 339

  Fly   431 GD-CQLGGFMTDAAQPNGSP---------NEILK----------C-YSTYEGFVSFR-TEDGTPF 473
            || ...|....|......||         .|::|          | |:..:|..:.| |:.|:.:
  Rat   340 GDETDRGVDQQDGKNHAQSPGCEESDAGKEELMKMRLPTRSDMICGYACLKGNAAMRNTKRGSWY 404

  Fly   474 IQTLCEALNRSGKTSDIDTIMMNVRQVVKMQS---------KDRQIPSVTSTLTSK-YVFGDY 526
            |:.|.:..:.......:..:::.|..::|.:.         :.:::....|||..: |:|..|
  Rat   405 IEALTQVFSERACDMHVADMLVKVNALIKEREGYAPGTEFHRCKEMSEYCSTLCQQLYLFPGY 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 53/253 (21%)
Casp2XP_038964243.1 CARD_CASP2 32..118 CDD:260040
CASc 192..465 CDD:214521 53/254 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.