DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp8

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_005165894.1 Gene:casp8 / 58022 ZFINID:ZDB-GENE-000713-1 Length:477 Species:Danio rerio


Alignment Length:268 Identity:74/268 - (27%)
Similarity:110/268 - (41%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 GTISTSLGISKSSLTKNKLKPARVYIF------------NHERFDNKNEF-RKGSAQDVKVLRAT 343
            |||:|.        .:..|.|...||.            |:....:.|.. |.|:..|...|...
Zfish   215 GTITTD--------AETPLNPNEYYILTQRPLGYCLIINNYNFLKSTNLLKRTGTDMDKDRLAKL 271

  Fly   344 FEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDDDVV 408
            |.::..::||.:|.....||..::....|:.....|.|..|||||.:...:........: .:|.
Zfish   272 FSRMHFQIEVRSDLEAWAIKDEIKQFANKNHASMGAFVCCILSHGEKGTVLGTDGKPVEI-REVT 335

  Fly   409 FPILRNRTLKDKPKLIFVQACKGDCQLGGFMT-----DAAQPNGSPNE---------------IL 453
            .|....|||..||||.|:|||:||....|..|     ||.:.:....|               .|
Zfish   336 LPFAGCRTLASKPKLFFIQACQGDENQAGVWTSDGREDAPEEDEKYEEDAGIIVLRKIPIEADFL 400

  Fly   454 KCYSTYEGFVSFR-TEDGTPFIQTLCEALNR-SGKTSDIDTIMMNVR-QVVKMQSKD-RQIPSVT 514
            ...:|.|.::|:| |::|:.|||.||:.:.. ..|..|:.:|:..|. :|.|...|. :|:|...
Zfish   401 IGMATVEHYLSYRHTKEGSIFIQELCKKMEELCPKKEDMLSILTKVNFEVSKRILKGYKQMPEPR 465

  Fly   515 STLTSKYV 522
            .|||.|.|
Zfish   466 YTLTKKLV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 69/249 (28%)
casp8XP_005165894.1 DED_Caspase_8_10_r1 2..76 CDD:260059
DED_Caspase_8_10_r2 96..176 CDD:260042
CASc 230..475 CDD:237997 68/245 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.