DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and caspa

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_571580.1 Gene:caspa / 57933 ZFINID:ZDB-GENE-000616-3 Length:383 Species:Danio rerio


Alignment Length:267 Identity:61/267 - (22%)
Similarity:110/267 - (41%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 KVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATF 344
            |||..  ||..:..|....|.....:....::.....:.|:..||:|...|.||.:|.:.:....
Zfish   114 KVTPC--SQQFKNKILREKGQETYEIKDKSVRKRLALLINNVDFDDKAMKRSGSEKDEENMEKLL 176

  Fly   345 EQLKCKVEVITDATLVTIKKTVR-MLQTKDFEDKSALVLVILSHGTRHDQIAA--------KDDD 400
            ::|..:|....:.:...:.:.:| ..|.::.:...:..:||:|||.| |.|..        ..|.
Zfish   177 KELDYQVVKRPNLSAKEMDEAIRDFAQREEHKYSDSAFVVIMSHGKR-DAIMGVHYHRTNNPSDS 240

  Fly   401 YSLDDDVVFPILRNR---TLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPNEI---------- 452
            :.:|:  |:..|.:.   .|:||||:|.:|||:|. :.|.......:|: .|.||          
Zfish   241 FPVDN--VYRRLNSENCPALRDKPKVILIQACRGG-EHGRVWASDGEPD-EPIEIEDDDFVHKEK 301

  Fly   453 --LKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVK------------ 502
              :...|......|:| .::||.::|||.:...:......|:.:.   |:|::            
Zfish   302 DFISLMSCTPDTKSYRHVQNGTFYVQTLVDVFIKCAHEDHIEELF---RKVLRRFEHPNMIGNFK 363

  Fly   503 -MQSKDR 508
             |..|||
Zfish   364 QMACKDR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 54/236 (23%)
caspaNP_571580.1 DD 6..85 CDD:417479
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106
CASc 134..380 CDD:237997 54/245 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.