DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and caspbl

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001139064.1 Gene:caspbl / 566185 ZFINID:ZDB-GENE-090311-53 Length:409 Species:Danio rerio


Alignment Length:264 Identity:66/264 - (25%)
Similarity:113/264 - (42%) Gaps:44/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 QGTISTSLGISKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVIT 355
            |.|:|....:|::.      :.....:..:..|.||.:.|.|:.:|.:.:....:.|...|....
Zfish   156 QNTLSIYTPVSRTQ------RKGLALLITNILFANKQDDRAGAERDEENMEWLLKNLNFMVIKYR 214

  Fly   356 DATLVTIKKTVRMLQTK-DFEDKSALVLVILSHGTR-----------HDQIAAKDDDYSLDDDVV 408
            :.|...|.:.|:....: :.:|..:..:||:|||.|           ::.:..::|.|.::|  .
Zfish   215 NLTGNEISRAVQDFSRRHEHQDADSTFVVIMSHGDRIQNKDAILGVNYNWLQNRNDVYFVED--T 277

  Fly   409 FPILRN---RTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGSPNEILK-----CY-STYEGFVS 464
            |..|.:   ..|.||||:|.:|||:|. ||||.......|. |.:.:.|     |: ||....|:
Zfish   278 FSHLNSVNCPALIDKPKVILIQACRGG-QLGGVPVKDCVPE-SDSWVHKEKDFVCFMSTMPDVVA 340

  Fly   465 FRTE-DGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQ-------IPSV--TSTLTS 519
            :|.| .|:.||..:.:....|...   |.||...|:|.....||.:       :|.:  ||.:..
Zfish   341 YRDEVKGSYFISYIVDVFCSSACK---DHIMELFRKVAARMEKDERFRRQAKLLPCIERTSLVKK 402

  Fly   520 KYVF 523
            .|:|
Zfish   403 FYLF 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 61/242 (25%)
caspblNP_001139064.1 Pyrin_ASC-like 5..84 CDD:260033
CASc 167..406 CDD:237997 61/251 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.