DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp23

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001103182.1 Gene:casp23 / 563034 ZFINID:ZDB-GENE-071004-27 Length:446 Species:Danio rerio


Alignment Length:217 Identity:61/217 - (28%)
Similarity:97/217 - (44%) Gaps:20/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 DNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVR-MLQTKDFEDKSALVLVILSH 387
            |.|:..|.|:.:|...:....:.|...|..:.|.:...:...:| ..|.|:..|..:..:|::||
Zfish   230 DFKDNVRTGADKDELSMERLLKGLGYSVVTLRDLSAQGMSTAMRDFSQRKEHADSDSCFVVLMSH 294

  Fly   388 GTRHDQIAAKDDDYSLDD----DVVFPILRNRT---LKDKPKLIFVQACKGDCQLGGFMTDAAQP 445
            |. ...|....|..|.||    |.:|..|....   |:||||:|.:|:|:|.......:.|:...
Zfish   295 GD-ESGICGIFDSSSQDDVFPPDEIFKCLNTPNCAGLRDKPKIILIQSCRGGKPGNVDVPDSVPI 358

  Fly   446 NGSPNEILK----CY-STYEGFVSFRT-EDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKM- 503
            .|:..|..:    |: |:....||:|. |.|:.|||.|.|..||.....||:.:...|  ::|. 
Zfish   359 RGTRREHKEKDFCCFRSSTPDTVSYRNKEKGSHFIQDLVEIFNRHAYEDDIEELFRKV--IMKFR 421

  Fly   504 QSKDRQIPSVTSTLTSK--YVF 523
            ::.|.|:|....|...|  |:|
Zfish   422 ETHDEQMPCKERTTLCKKFYLF 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 60/215 (28%)
casp23NP_001103182.1 CASc 210..444 CDD:320727 61/217 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.