DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp7

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001018443.1 Gene:casp7 / 553634 ZFINID:ZDB-GENE-050522-506 Length:316 Species:Danio rerio


Alignment Length:253 Identity:72/253 - (28%)
Similarity:107/253 - (42%) Gaps:47/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 KLKPARV---YIFNHERFDNKN--EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRM 368
            |:...||   .|.|::.||.|.  ..|.|:.:|...|...|:.|...|.|..|.|...:::.::.
Zfish    72 KMSHQRVGKCIIINNKNFDEKTGMNVRNGTDRDAGELFKCFKSLGFDVAVYNDQTCRNMERLLKA 136

  Fly   369 LQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDDDVVFPILRN---------RTLKDKPKLI 424
            :..:|..|.|....::||||         ::......|...||...         ::|..||||.
Zfish   137 VSEEDHSDSSCFACILLSHG---------EEGMIYGTDGAMPIKTMTSLFKGDVCKSLVGKPKLF 192

  Fly   425 FVQACKGDCQLGGFMTDAAQPN------GSPN-------EILKCYSTYEGFVSFRTED-GTPFIQ 475
            |:|||:|.....|..||:..||      .:|.       :.|..|||..|:.|:|... |:.|:|
Zfish   193 FIQACRGSEFDDGVQTDSGPPNDTIETDANPRHKIPVEADFLFAYSTVPGYYSWRNPGRGSWFVQ 257

  Fly   476 TLCEALNRSGKTSDIDTIMMNVRQVVKMQ----------SKDRQIPSVTSTLTSKYVF 523
            .||..|:..||..:|..|:..|..:|...          |:.:|||.|.|.||.:..|
Zfish   258 ALCNVLSEFGKQLEIMQILTRVNYMVATSFESWSEDPRFSEKKQIPCVVSMLTKELYF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 70/249 (28%)
casp7NP_001018443.1 CASc 71..315 CDD:237997 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.