DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp6

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001011068.1 Gene:casp6 / 496478 XenbaseID:XB-GENE-482797 Length:304 Species:Xenopus tropicalis


Alignment Length:299 Identity:74/299 - (24%)
Similarity:121/299 - (40%) Gaps:64/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 SSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVY-----------IFNHERF--D 324
            |:|..:...::.:|:::.:..::.:.|.:..:|   :|.|:..|           |||||.|  .
 Frog    11 SAGQIEKDSSSASQNKEQKANVAETDGWTSRTL---ELDPSAEYKMTHKRRGLALIFNHEDFYWQ 72

  Fly   325 NKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHG- 388
            .:...|:|:..|...|......|...|:...:...:.|.:.::...|.|..:....:.|.|||| 
 Frog    73 LRLGSRRGTNTDSMNLNRILTDLGFDVQNYYNLRTLDILEKIQEASTADHSNADCFLCVFLSHGE 137

  Fly   389 TRHDQIAAKDDDYSLDDDVVFPILRN-------RTLKDKPKLIFVQACKGDCQLGGFM------- 439
            .||        .||.|..:....|.|       .:|..|||:...|||:|:......:       
 Frog   138 DRH--------IYSYDSLIDIQELTNSFKGDKCESLVGKPKIFIFQACRGEKHDNPVLPTDETDS 194

  Fly   440 --------TDAAQ----PNGSPNEILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDID 491
                    .|||.    |.|:  :.:.|||..||:.|.| |.:|:.:||.|||.|.....:.:..
 Frog   195 VTLTNITEVDAASLYTLPAGA--DFIMCYSVAEGYYSHRETVNGSWYIQDLCEVLKAHAASLEFT 257

  Fly   492 TIMMNVRQVVKMQS----------KDRQIPSVTSTLTSK 520
            .|:..|.:.|..:|          ..:|||..:|.||.|
 Frog   258 EILTLVNRKVSQRSVAFCNDPKAIGKKQIPCFSSMLTKK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 68/261 (26%)
casp6NP_001011068.1 CASc 51..300 CDD:237997 67/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.