DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Dcp-1

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_476974.1 Gene:Dcp-1 / 37729 FlyBaseID:FBgn0010501 Length:323 Species:Drosophila melanogaster


Alignment Length:305 Identity:95/305 - (31%)
Similarity:136/305 - (44%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 ISLGSSGGTKPKVTAV-AQSQDAQGTISTSLGI----SKSSLTKNKL---KPARVY--------- 316
            :.:.|..|::.:.:.: |.:.||:|....||.:    :.|.|..||.   .|...|         
  Fly    12 VGIRSPNGSENRGSFIMADNTDAKGCTPESLVVGGATAASPLPANKFVARMPVERYASEYNMSHK 76

  Fly   317 ------IFNHERFDNKN-EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDF 374
                  |||||.||..: :.|.|:..|.:.|:..||.|...|.|..|..|..|.|.|......|.
  Fly    77 HRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSVHKDCKLRDILKHVGKAAELDH 141

  Fly   375 EDKSALVLVILSHGTRHDQIAAKDDDYSLDDD-VVFPILRNRTLKDKPKLIFVQACKGDCQLGGF 438
            .|...|.:.||||| .|..:.|||..|.||:. ..|......:|..||||.|:|||:||...||.
  Fly   142 TDNDCLAVAILSHG-EHGYLYAKDTQYKLDNIWHYFTATFCPSLAGKPKLFFIQACQGDRLDGGI 205

  Fly   439 MTD--AAQPNGSPN---------EILKCYSTYEGFVSFRT-EDGTPFIQTLCEALNRSGKTSDID 491
            ..:  ..:.:|..:         :.|..|||..|:.|:|. .:|:.::|:|...||.:||..|:.
  Fly   206 TLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGYFSWRNINNGSWYMQSLIRELNANGKKYDLL 270

  Fly   492 TIMMNVRQVV-----------KMQSKDRQIPSVTSTLTSKYVFGD 525
            |::..|.|.|           .|..:.:|||.:||.||....|||
  Fly   271 TLLTFVNQRVALDFESNVPATPMMDRQKQIPCLTSMLTRILRFGD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 80/251 (32%)
Dcp-1NP_476974.1 CASc 71..313 CDD:214521 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.