DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp2

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_005157976.1 Gene:casp2 / 373118 ZFINID:ZDB-GENE-030825-3 Length:437 Species:Danio rerio


Alignment Length:395 Identity:84/395 - (21%)
Similarity:152/395 - (38%) Gaps:96/395 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 SSSSASSITSPPKPSSSVSS-------------ISSIFKSAPKQVDKP------LSSTATPKPFI 269
            :.|.|.||.:  ||:|...|             ..|.|.||.|:.::.      :..|...|.|.
Zfish    43 TDSMAESIMA--KPTSQGRSHQLLFLLPKRGPRAFSTFCSALKETEQHHLCKLLMDFTEKDKCFS 105

  Fly   270 SLGSSGGTKPKVTAVAQSQ---------DAQGTISTSLGISKSSLTKN---KLKPAR------VY 316
            ....|..|:..||...:.:         ||...::|::........::   :..|.|      ..
Zfish   106 EPSLSLPTQECVTPAKRPRTHESMEMCLDADSPVTTAVLPCTPEFYQSHRPQAYPMRSCPRGLAL 170

  Fly   317 IFNHERFDNKN---EFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTV-RMLQTKDFEDK 377
            :.::.|||:.|   :.|:|...|.:.||..|.:|..||.:..|.|...:::.: :..|.::....
Zfish   171 VLSNVRFDSANTDLDIRRGGEVDEETLRRLFTELDFKVSLHRDLTAEAMRRCLEQFAQQQEHAAY 235

  Fly   378 SALVLVILSHGTRHDQIAAKDDDYSLDDDVVFPILRNR---TLKDKPKLIFVQACKGDCQLGGF- 438
            ...|:.:||||........  |...|:.|.||.:..|.   .|::|||:.|:|||:|:....|. 
Zfish   236 DCAVVCLLSHGVEGSVYGT--DGQLLELDWVFEVFDNARCPLLQNKPKMFFIQACRGEEMDNGVD 298

  Fly   439 MTDAAQPNGSP----------------------------------NEILKCYSTYEGFVSF---R 466
            ..|..:...||                                  ::::..::|.:||.:.   .
Zfish   299 QLDGQERTQSPGCEQRDAGREGERDNREKKEEKERERLRVKLPQRSDMICGFATLKGFSTAAMRN 363

  Fly   467 TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQS---------KDRQIPSVTSTLTSK-Y 521
            |:.|:.|||.|..|:.:....:.:..|::.|...:|.:.         :.:::...||:|... |
Zfish   364 TKKGSWFIQELNTAIRQRANNTHLSDILVQVNGQIKSREGYAPGSAHHRCKEMSEFTSSLCKDLY 428

  Fly   522 VFGDY 526
            :|..|
Zfish   429 LFPKY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 59/272 (22%)
casp2XP_005157976.1 CARD_CASP2 7..94 CDD:260040 13/52 (25%)
CASc 158..430 CDD:237997 59/273 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.