DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Damm

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001303345.1 Gene:Damm / 36266 FlyBaseID:FBgn0033659 Length:255 Species:Drosophila melanogaster


Alignment Length:225 Identity:102/225 - (45%)
Similarity:139/225 - (61%) Gaps:14/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 KLKPARVYIFNHERFDNKNEF-RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTK 372
            ||||..|||.|||:|...::. ||||:.||..||.|||.|||:||||::..|..:|..|:....|
  Fly    34 KLKPPAVYILNHEQFPQDSQLNRKGSSNDVNALRKTFESLKCRVEVISNPALPDVKNKVKEWSAK 98

  Fly   373 DFEDKSALVLVILSHGTRHDQIAAKDD-DYSLDDDVVFPILRNRTLKDKPKLIFVQACKGDCQLG 436
            .|...:..||.|||||.|.::|.|.|. :|.|||||:||:.||.||..|||::.||||||..:  
  Fly    99 RFTQDAGFVLFILSHGDRKEKILACDHREYHLDDDVLFPLFRNPTLSGKPKILIVQACKGPLR-- 161

  Fly   437 GFMTDAAQPNGSPNEILKCYSTYEGFVSFRTED-GTPFIQTLCEALNRSGKTSDIDTIMMNVRQV 500
               .||.:.|..|  .:||||..||::|:|.|: |:.||||||||:::.|.|.|..:|..:|:..
  Fly   162 ---ADAKKMNNEP--YIKCYSCSEGYLSYRNENHGSVFIQTLCEAMDQYGLTRDFQSIFKHVKAE 221

  Fly   501 VKMQSK---DRQIPSVTS-TLTSKYVFGDY 526
            |:.:|.   .:|:||..| .....:.||:|
  Fly   222 VERRSTMTGSKQVPSEESHNFDKPFYFGNY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 97/218 (44%)
DammNP_001303345.1 Peptidase_C14 42..248 CDD:279049 93/212 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452838
Domainoid 1 1.000 111 1.000 Domainoid score I12140
eggNOG 1 0.900 - - E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019919
OrthoInspector 1 1.000 - - mtm9711
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.