DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp14

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001178705.1 Gene:Casp14 / 299587 RGDID:1311781 Length:246 Species:Rattus norvegicus


Alignment Length:240 Identity:63/240 - (26%)
Similarity:111/240 - (46%) Gaps:51/240 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 ERFDNK----------NEFRKGSAQDVKVLRATFEQLKCKVEVITDAT-------LVTIKKTVRM 368
            ||:|..          .:.|:||..|:..|...|:.||.:..:..|.|       :...::|:..
  Rat    14 ERYDMSGARLALTLCVTKAREGSEVDMDALERMFQYLKFESTMKRDPTAQQFLDDMDEFQQTIEN 78

  Fly   369 LQTKDFEDKSALVLVILSHGTRHDQIAAKDDD---YSLDDDVVFPILRN---RTLKDKPKLIFVQ 427
            .:    |..|...:|:::||   ::...|.:|   ..|:|  :|.:|.|   :.|:.|||:..:|
  Rat    79 WK----EPVSCAFVVLMAHG---EEGFLKGEDGNMVRLED--LFEVLNNKNCKALRGKPKVYIIQ 134

  Fly   428 ACKGDC-----QLGGFMTDAAQPNGSP-----NEILKCYSTYEGFVSFR-TEDGTPFIQTLCEA- 480
            ||:|:.     :|.|......:....|     .:::..|||.|||:|:| .:.|:.|||||.:. 
  Rat   135 ACRGEHRDPGEELPGDELAVIKKKNPPTIPTYTDMIHIYSTVEGFLSYRHDQKGSGFIQTLTDVF 199

  Fly   481 LNRSGKTS----DIDTIMMNVRQVVKMQSKDRQI-PSVTSTLTSK 520
            :::.|..:    :|..:|.|..  |..:.|.|:: |.:.|||..|
  Rat   200 IHKKGSITELLEEITRLMANTE--VMQEGKPRKVNPEIQSTLRKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 63/240 (26%)
Casp14NP_001178705.1 CASc 10..246 CDD:237997 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.