DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp1

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_036894.3 Gene:Casp1 / 25166 RGDID:2274 Length:402 Species:Rattus norvegicus


Alignment Length:331 Identity:82/331 - (24%)
Similarity:141/331 - (42%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 SISSIFKSAPKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTIS-TSLGISKSSLT 306
            |..::|.:...:...|.||....|    |...||..|         ...|::. ..|.|::....
  Rat    94 SAETVFVTEDSKGGHPFSSETKEK----LNKEGGAFP---------GPSGSLKFCPLEIAQKLWK 145

  Fly   307 KNKLK-------PAR---VYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVT 361
            :|..:       |.|   ..|..:..|.:.:. |.|:..|::.::...:.|...|:|..:.|.:.
  Rat   146 ENHSEIYPIMKTPTRTRLALIICNTDFQHLSR-RVGADVDLREMKLLLQDLGYTVKVKENLTALE 209

  Fly   362 IKKTVRMLQTKDF----EDKS--ALVLVILSHG--------TRHDQIAAKDDDYSLDDDVVFPI- 411
            :.|     :.|:|    |.|:  :..||.:|||        |..:::|.     .|..|.:|.: 
  Rat   210 MTK-----ELKEFAACPEHKTSDSTFLVFMSHGLQEGICGITYSNEVAD-----ILKVDTIFQMM 264

  Fly   412 --LRNRTLKDKPKLIFVQACKGDCQ--------LG----GFMTDAA-QPNG------SPNEILKC 455
              |:..:||||||:|.:|||:|:.|        :|    ||:|||. :.:|      ..:.|..|
  Rat   265 NTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGNSEEGFLTDAIFEDDGIKKAHIEKDFIAFC 329

  Fly   456 YSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTS-TLT 518
            .||.:. ||:| ...|:.||::|.:.:.....:.|::.|...||...:......|:|:... |||
  Rat   330 SSTPDN-VSWRHPVQGSLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPDSRLQMPTTERVTLT 393

  Fly   519 SK-YVF 523
            .: |:|
  Rat   394 KRFYLF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 67/260 (26%)
Casp1NP_036894.3 CARD_CASP1-like 6..87 CDD:260036
CASc 152..400 CDD:214521 68/260 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.