DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp12

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_569106.1 Gene:Casp12 / 156117 RGDID:621758 Length:420 Species:Rattus norvegicus


Alignment Length:246 Identity:44/246 - (17%)
Similarity:97/246 - (39%) Gaps:50/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLVTIK-KTVRMLQTKDFEDKSAL 380
            |..:::||...: |..:..|:..::...:.|...|.:..:.|...:: :.::.....:.:...:.
  Rat   181 IICNKKFDYLFD-RDDAETDILNMKELLQNLGYSVVIKENLTAQEMETELMKFAGRPEHQSSDST 244

  Fly   381 VLVILSHGTRHDQIAAKDDDYS---LDDDVVFPILRNR---TLKDKPKLIFVQACKG-------- 431
            .||.:|||........|..:..   |.||.:|.|..|.   :|::|||::.:|||:|        
  Rat   245 FLVFMSHGILEGICGVKHRNKKPDVLHDDTIFTIFNNSNCPSLRNKPKILIMQACRGRHTGTIWV 309

  Fly   432 -------------DCQLGGFMTDAAQPNGSPNEILKCYSTYEGFVSFRT-----------EDGTP 472
                         :|.|.         :...|.|.|.:...: |::|::           :.|:.
  Rat   310 STSKGIATADTDEECVLS---------HRWNNSITKAHVETD-FIAFKSSTPHNISWKVGKSGSL 364

  Fly   473 FIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTSTLTSKYVF 523
            ||..|.:...:......::.|...|:...::..:..|:|::.....::|.:
  Rat   365 FISKLIDCFKKYCWCYHLEEIFRKVQYSFEVPGELTQMPTIERVSMTRYFY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 44/244 (18%)
Casp12NP_569106.1 CARD_CASP1-like 6..88 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..115
CASc 167..418 CDD:214521 44/246 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.