DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp3a

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_571952.1 Gene:casp3a / 140621 ZFINID:ZDB-GENE-011210-1 Length:282 Species:Danio rerio


Alignment Length:232 Identity:69/232 - (29%)
Similarity:105/232 - (45%) Gaps:28/232 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   317 IFNHERFDNKNEF--RKGSAQDVKVLRATFEQLKCKVEVITDATLVTIKKTVRMLQTKDFEDKSA 379
            |.|::.||.:...  |.|:..|...:...|.:|...|:|..|.|:..|.:.:..:...|....::
Zfish    52 IINNKNFDRRTGMNPRNGTDVDAGNVMNVFRKLGYIVKVYNDQTVAQIMQVLTTVAHDDHSRCAS 116

  Fly   380 LVLVILSHGTRHDQIAAKDDDYSLDDDVVFPILRN---RTLKDKPKLIFVQACKGDCQLGGFMTD 441
            ||.|:||||   |:......|.|:|...:..:.|.   .:|..||||.|:|||:|.....|..||
Zfish   117 LVCVLLSHG---DEGVFFGTDTSVDLKSLTSLFRGDRCPSLVGKPKLFFIQACRGTELDPGVETD 178

  Fly   442 AAQ----PNGSPN-----EILKCYSTYEGFVSFR-TEDGTPFIQTLCEALNRSGKTSDIDTIMMN 496
            ...    |:|...     :.|..|||..|:.|:| |..|:.|||:|||.:.:.|...::..||..
Zfish   179 HTDHPDIPDGRERIPVEADFLYAYSTVPGYYSWRNTMTGSWFIQSLCEMMTKYGSELELLQIMTR 243

  Fly   497 VRQVVKMQSKD----------RQIPSVTSTLTSKYVF 523
            |...|.:..:.          :|||.:.|.||.:..|
Zfish   244 VNHKVALDFESTSNMPGFDAKKQIPCIVSMLTKEMYF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 68/230 (30%)
casp3aNP_571952.1 CASc 39..280 CDD:237997 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.