DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp12

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_036010474.1 Gene:Casp12 / 12364 MGIID:1312922 Length:425 Species:Mus musculus


Alignment Length:395 Identity:72/395 - (18%)
Similarity:144/395 - (36%) Gaps:84/395 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ASTANSSTSSYVSPYRQKPSMAITCTSPNIKTPKTT-----SSTSSSSASSITSPPKPSSSVSSI 244
            ||...:...:.|..:.:|..||....:.:|...:..     |:........|.:|..||.|    
Mouse    54 ASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPSES---- 114

  Fly   245 SSIFKSAPKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNK 309
                |...:..:..:::....:..:.|.:..|        .||.:.|.|:..   ..:....|.|
Mouse   115 ----KRKVEDDEMEVNAGLAHESHLMLTAPHG--------LQSSEVQDTLKL---CPRDQFCKIK 164

  Fly   310 LKPAR-VY-------------IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDATLV 360
            .:.|: :|             |..:::||...: |..:..|:..::...|.|  ...|:....|.
Mouse   165 TERAKEIYPVMEKEGRTRLALIICNKKFDYLFD-RDNADTDILNMQELLENL--GYSVVLKENLT 226

  Fly   361 TIKKTVRMLQ---TKDFEDKSALVLVILSH-------GTRHDQIAAKDDDYSLDDDVVFPILRN- 414
            ..:....::|   ..:.:...:..||.:||       |.:|..   |..|. |.||.:|.|..| 
Mouse   227 AQEMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRN---KKPDV-LHDDTIFKIFNNS 287

  Fly   415 --RTLKDKPKLIFVQACKGDCQLGGFM-----TDAAQPNGSPNEILKC--------YSTYEGFVS 464
              |:|::|||::.:|||:|  :..|.:     ...|..:.....:|.|        ......|::
Mouse   288 NCRSLRNKPKILIMQACRG--RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIA 350

  Fly   465 FRT-----------EDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTSTLT 518
            |::           :.|:.||..|.:...:......::.|...|:...::..:..|:|::.....
Mouse   351 FKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSM 415

  Fly   519 SKYVF 523
            ::|.:
Mouse   416 TRYFY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 50/262 (19%)
Casp12XP_036010474.1 CARD_CASP1-like 12..94 CDD:260036 7/39 (18%)
CASc 172..423 CDD:214521 49/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.