DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Casp1

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_033937.2 Gene:Casp1 / 12362 MGIID:96544 Length:402 Species:Mus musculus


Alignment Length:315 Identity:78/315 - (24%)
Similarity:134/315 - (42%) Gaps:54/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LSSTATPKPFISLGSSGGTKPKVTAVAQSQDAQ-GTISTSLGISK-SSLTKN----KLKPARVY- 316
            |.|..:.:.|::...|.|..|..:...:.|:.: ||.....|..| ..|.|.    |..|:.:| 
Mouse    89 LQSAPSAETFVATEDSKGGHPSSSETKEEQNKEDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYP 153

  Fly   317 ------------IFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVEVITDAT-LVTIKKTVRM 368
                        |..:..|.:.:. |.|:..|::.::...|.|...|:|..:.| |..:|:....
Mouse   154 IMNTTTRTRLALIICNTEFQHLSP-RVGAQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEF 217

  Fly   369 LQTKDFEDKSALVLVILSHGTRHDQIAAKDDDYSLDD----DVVFPI---LRNRTLKDKPKLIFV 426
            ....:.:...:..||.:|||.: :.|........:.|    |.:|.:   |:..:||||||:|.:
Mouse   218 AACPEHKTSDSTFLVFMSHGIQ-EGICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIII 281

  Fly   427 QACKGDCQLG-------------GFMTDAA-QPNG------SPNEILKCYSTYEGFVSFR-TEDG 470
            |||:|:.| |             .|:|||. :.:|      ..:.|..|.||.:. ||:| ...|
Mouse   282 QACRGEKQ-GVVLLKDSVRDSEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDN-VSWRHPVRG 344

  Fly   471 TPFIQTLCEALNRSGKTSDIDTIMMNVRQVVKMQSKDRQIPSVTS-TLTSK-YVF 523
            :.||::|.:.:.....:.|::.|...||...:......|:|:... |||.: |:|
Mouse   345 SLFIESLIKHMKEYAWSCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 63/255 (25%)
Casp1NP_033937.2 CARD_CASP1-like 6..87 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..125 6/26 (23%)
CASc 152..400 CDD:214521 63/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.