DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and Cflar

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001029036.1 Gene:Cflar / 117279 RGDID:620847 Length:480 Species:Rattus norvegicus


Alignment Length:227 Identity:53/227 - (23%)
Similarity:93/227 - (40%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 DVKVLRATFEQLKCKVEVITDATLVTIKKTVR----MLQTKDFEDKSALVLVILSHGTRH----- 391
            |.:.||.||..|..:|:.....:...|.:.||    |.|.:|::   :.|.|::|.|...     
  Rat   268 DTEYLRETFTSLGYRVQPFLFPSSHEITQIVRRFSNMTQHQDYD---SFVCVLVSRGGSQSMMGV 329

  Fly   392 DQIAAKDDDYSLDD--DV----VFPILRNRTLKDKPKLIFVQACK----GDCQLGGFMTDAAQPN 446
            ||:.:   .:||::  |:    :.|.||.     ||||.|:|..:    ...::.|    .|..|
  Rat   330 DQVYS---GFSLENVKDMFKGDMCPSLRG-----KPKLFFIQNYEALEDNSLEVDG----PAIKN 382

  Fly   447 GSPNEILKCYST----YEGFVSFRTEDG----------TPFIQTLCEALNRSGKTSDIDTIMMNV 497
            .:...:...:.|    .:.|.|..|.|.          :.::|.|.:.|.:..|.|.:|   ::|
  Rat   383 VNSRHLHPRHCTTHPDADIFWSLCTADVSRLEQPSSSLSVYLQKLSQLLEQGRKRSLVD---LHV 444

  Fly   498 RQVVK-------MQSKDRQIPSVTSTLTSKYV 522
            ..:.|       :.||::...|:..||..|.:
  Rat   445 ELMDKVYAWNSNVPSKEKYYLSLQHTLRKKLI 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 53/227 (23%)
CflarNP_001029036.1 DED_c-FLIP_r1 6..85 CDD:260044
DED_c-FLIP_r2 96..176 CDD:260046
CASc 249..479 CDD:412128 53/227 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.