DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and casp21

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:NP_001373247.1 Gene:casp21 / 100331324 ZFINID:ZDB-GENE-190425-1 Length:266 Species:Danio rerio


Alignment Length:262 Identity:77/262 - (29%)
Similarity:122/262 - (46%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 SLGISK--SSLTK-------NKLKP-ARVYIFNHERF-DNKNEFRKGSAQDVKVLRATFEQLKCK 350
            ||..||  |::||       .|.|. .:..|.::|.| |:...:|||::.|.:.|.:||:.|...
Zfish     2 SLQASKDNSAVTKPCAFEPYKKHKNIGKCLIISNEHFPDSPRLYRKGNSVDERRLSSTFKSLGFH 66

  Fly   351 VEVITDATLVTIKKTVRMLQTKDFEDKSALVLVILSHGTRHDQIAAKDDDY-------SLDDDVV 408
            |:|..:.:...:...:|.:..:|..|.|..|.|::||| ....|...|:.:       ||....:
Zfish    67 VKVENNLSANQMIDALRTVSEEDHTDNSCFVCVLMSHG-EEGTILGSDERWIPVKTLTSLLTSDL 130

  Fly   409 FPILRNRTLKDKPKLIFVQACKGDCQLGGFMTDAAQPNGS-------PN-EILKCYSTYEGFVSF 465
            .|     :|:||||:.|:|||:|.....|...|:.:.:..       |. :.|.||||.||:.::
Zfish   131 CP-----SLRDKPKIFFLQACRGVEYDPGVEADSVEASEDFFGISDVPELDFLCCYSTVEGYFAW 190

  Fly   466 RT-EDGTPFIQTLCEALNRSGKTSDIDTIMMNVRQVVK--MQS--------KDRQIPSVTSTLTS 519
            |. |.|:.||:.||:.|  .....:|..|:..|..:|.  .||        :.||:|...|.||.
Zfish   191 RNPETGSIFIRELCKTL--MDCRLEIIQILTRVNHLVAYYFQSYTLELETNRKRQMPCFASRLTK 253

  Fly   520 KY 521
            .:
Zfish   254 DF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 69/239 (29%)
casp21NP_001373247.1 CASc 20..257 CDD:237997 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.