DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strica and si:ch211-195h23.3

DIOPT Version :9

Sequence 1:NP_001260718.1 Gene:Strica / 35528 FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster
Sequence 2:XP_021334238.1 Gene:si:ch211-195h23.3 / 100170660 ZFINID:ZDB-GENE-070912-174 Length:1001 Species:Danio rerio


Alignment Length:217 Identity:37/217 - (17%)
Similarity:68/217 - (31%) Gaps:81/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 KTTSSTSSSSA-------SSITSPPKPSSSVSSISSIFKSAPKQVDKPLSSTA---TPKPFISLG 272
            |...:..|.||       .|:.|||:..||..              :|.|.:|   ||:...::.
Zfish   582 KIVQADESLSAVEQEKEGKSLGSPPRAESSTG--------------QPTSESAEEFTPELIQTVD 632

  Fly   273 S-------------SGGTKPKVTAVAQSQDAQGTISTSLGISKSSLTKNKLKPARVYIFNHERFD 324
            .             :|..:..:|::....|.:|.:.                 .||..::....|
Zfish   633 EDKHKNTYRFVCPHAGQFQCSLTSLVFVMDGEGELL-----------------YRVVSWDPRLLD 680

  Fly   325 NKNEFR-KGSAQDVKVLRATFEQL---KCKV--------------------EVITDATLVTIKKT 365
            ...:.: .|...|||....:..:|   .|::                    |::..   :|:.:|
Zfish   681 GLGQMQPAGPLYDVKCFNGSISKLHLPHCEIFSEGDNMDGLAVAHFTGGNMEIVQP---ITVTET 742

  Fly   366 VRMLQTKDFEDKSALVLVILSH 387
            ..|:..:|......|.:.|.||
Zfish   743 HVMIDIRDLSLFGLLWMKIFSH 764

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
StricaNP_001260718.1 CASc 311..523 CDD:294037 18/101 (18%)
si:ch211-195h23.3XP_021334238.1 P-loop_NTPase 51..307 CDD:328724
GBP_C 315..602 CDD:293879 4/19 (21%)
coiled coil 573..584 CDD:293879 1/1 (100%)
coiled coil 593..602 CDD:293879 0/8 (0%)
FIIND 645..885 CDD:316110 22/140 (16%)
CARD_ASC_NALP1 910..991 CDD:260039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.