DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pngl and W04G5.9

DIOPT Version :9

Sequence 1:NP_610192.1 Gene:Pngl / 35527 FlyBaseID:FBgn0033050 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001364612.1 Gene:W04G5.9 / 189204 WormBaseID:WBGene00012269 Length:407 Species:Caenorhabditis elegans


Alignment Length:159 Identity:35/159 - (22%)
Similarity:52/159 - (32%) Gaps:46/159 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 LNVRYSCATDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTDCGEI 543
            |:..|....|.|.:..:.|....:.|           .|||.|..:.:....|...::..|.|.|
 Worm   258 LDFEYDIVKDKYSQSPENGLFSQVYD-----------VKNIRRIRDTNTNEVYFGLVDGADHGTI 311

  Fly   544 AWTFDFSKTNLKV------------KSYN--------LVFETKTFGDGKISVTVDATDGSASVEN 588
            :|.||....|.|:            .|||        :..|........::...|...|..:|  
 Worm   312 SWRFDKDLNNNKIGRVDIEVRDDEEYSYNGKAIATFCIADECWIIRRNSVTSIYDTKHGQINV-- 374

  Fly   589 ATGFKIVAKLTGGKGDVAWQHTQLFRQSL 617
                  :..||||       ..|:||:||
 Worm   375 ------IFILTGG-------DAQIFRRSL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnglNP_610192.1 PUB 30..107 CDD:286494
CitX 98..>185 CDD:294885
Transglut_core <278..341 CDD:280085
YebA <282..378 CDD:224224
Rad4 <325..>383 CDD:281786
PAW 444..630 CDD:282564 35/159 (22%)
W04G5.9NP_001364612.1 PAW 252..339 CDD:214745 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157785
Domainoid 1 1.000 61 1.000 Domainoid score I6914
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.