DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pngl and W04G5.5

DIOPT Version :9

Sequence 1:NP_610192.1 Gene:Pngl / 35527 FlyBaseID:FBgn0033050 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_492967.4 Gene:W04G5.5 / 189201 WormBaseID:WBGene00012266 Length:412 Species:Caenorhabditis elegans


Alignment Length:223 Identity:42/223 - (18%)
Similarity:69/223 - (30%) Gaps:69/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 IGLT-------LERKPTENELKGRSSGSLSWRQSRGEHTFTNIFVFNLSATELQKRQLNVRYSCA 486
            :|||       |:..|..|    .|..|:....:.||                  ..:...|...
 Worm    53 LGLTELLFDERLQESPPHN----FSGKSIELTLNPGE------------------EYIKFTYDVI 95

  Fly   487 TDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTDCGEIAWTFDFSK 551
            .|.|....|:|           :....:..:|:.|..|.|..|.:|.::...|...|:|.||...
 Worm    96 NDVYSHSPKKG-----------FMAQAYYMENMKRCEEPDHIMVHLCKISIDDEATISWHFDLKS 149

  Fly   552 TNLKVKSYNL------VFETKTFGDGKISV----TVDATDGSASVEN--ATGFKIVAKLTGGKGD 604
            ....:|...:      .|...:....|..:    .|.|.:....::|  .:.|.:...|.|    
 Worm   150 IERPIKKVEVRMGGFAEFSGSSLARAKACIGNVCRVLANNNIERIDNPDISIFTVTVMLLG---- 210

  Fly   605 VAWQHTQLFRQSLNS---------RDYP 623
                ::|:||.:.|.         |.||
 Worm   211 ----NSQIFRTNWNKGTEIESFLVRIYP 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnglNP_610192.1 PUB 30..107 CDD:286494
CitX 98..>185 CDD:294885
Transglut_core <278..341 CDD:280085
YebA <282..378 CDD:224224
Rad4 <325..>383 CDD:281786
PAW 444..630 CDD:282564 36/201 (18%)
W04G5.5NP_492967.4 PAW 82..169 CDD:214745 20/115 (17%)
PAW 255..342 CDD:214745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157790
Domainoid 1 1.000 61 1.000 Domainoid score I6914
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522988at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.