Sequence 1: | NP_610192.1 | Gene: | Pngl / 35527 | FlyBaseID: | FBgn0033050 | Length: | 631 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492967.4 | Gene: | W04G5.5 / 189201 | WormBaseID: | WBGene00012266 | Length: | 412 | Species: | Caenorhabditis elegans |
Alignment Length: | 223 | Identity: | 42/223 - (18%) |
---|---|---|---|
Similarity: | 69/223 - (30%) | Gaps: | 69/223 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 IGLT-------LERKPTENELKGRSSGSLSWRQSRGEHTFTNIFVFNLSATELQKRQLNVRYSCA 486
Fly 487 TDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTDCGEIAWTFDFSK 551
Fly 552 TNLKVKSYNL------VFETKTFGDGKISV----TVDATDGSASVEN--ATGFKIVAKLTGGKGD 604
Fly 605 VAWQHTQLFRQSLNS---------RDYP 623 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pngl | NP_610192.1 | PUB | 30..107 | CDD:286494 | |
CitX | 98..>185 | CDD:294885 | |||
Transglut_core | <278..341 | CDD:280085 | |||
YebA | <282..378 | CDD:224224 | |||
Rad4 | <325..>383 | CDD:281786 | |||
PAW | 444..630 | CDD:282564 | 36/201 (18%) | ||
W04G5.5 | NP_492967.4 | PAW | 82..169 | CDD:214745 | 20/115 (17%) |
PAW | 255..342 | CDD:214745 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157790 | |
Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I6914 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D522988at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |