DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pngl and C04E12.5

DIOPT Version :9

Sequence 1:NP_610192.1 Gene:Pngl / 35527 FlyBaseID:FBgn0033050 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_001309618.1 Gene:C04E12.5 / 182210 WormBaseID:WBGene00015435 Length:484 Species:Caenorhabditis elegans


Alignment Length:350 Identity:65/350 - (18%)
Similarity:120/350 - (34%) Gaps:101/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 VDPSENVIDSPLMYQHGWKRHIDYILAYSRDDIQDVTWRYT--NDHQKILH-LRKLCGEKEMVQT 400
            ||..|.|:|.        |.:..|:.....||..::.|.::  ||.:.:.. :..:.|.:|:|..
 Worm   155 VDKIERVVDR--------KNNEAYLHQEFPDDFSNMYWAFSLKNDGKSVEKVVISIPGIEEIVNN 211

  Fly   401 LDAIRAKRRQNC----------TADRKLFLSQR--NMYEVIGLTLERKPTENELKGRSS------ 447
                ||...:.|          ..::.|.:.|:  .:|..|.|..:.|..:.:|||.|:      
 Worm   212 ----RAGVVETCPNFLINCFNIPVEKSLTIEQQMDKLYISIMLQKDIKVLKTKLKGVSNVESFKI 272

  Fly   448 -----------------GSLSWRQSRGEHTFTNIFVFNLSATELQKRQ-------------LNVR 482
                             ||::..:|............::|:|.|.:.|             ....
 Worm   273 EVYWKNMTMDSPTTTTPGSIATTKSSTTTITETHHQPDISSTRLTEHQDIIQLTPKSGQDYAKFT 337

  Fly   483 YSCATDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTD--CGEIAW 545
            |...::||.:..::|..:           ..:.:.|:...|:|...:||:...|..:  .|.|.|
 Worm   338 YDVISNTYSQSNEDGSPV-----------KPYLASNVEHVVDRRLNVAYIHMKEPINKRIGLINW 391

  Fly   546 TFDFSKTNLKVKSYNLVFETKTFGDGKI---------------SVTVDATDGSASVENATGFKIV 595
            .|||......|:.    .|.|..|..:|               ..|....:||.::|.....|..
 Worm   392 EFDFRFPGRSVEK----LEIKLTGMDEIVHNGGTANACLHDSFKCTAIPINGSLTIEKPQFNKFF 452

  Fly   596 AKLTGGKGDVAWQHTQLFRQSLNSR 620
            .::.      .::..::|:..||.|
 Worm   453 MQIE------LFKDIKVFKTELNDR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnglNP_610192.1 PUB 30..107 CDD:286494
CitX 98..>185 CDD:294885
Transglut_core <278..341 CDD:280085 1/1 (100%)
YebA <282..378 CDD:224224 10/38 (26%)
Rad4 <325..>383 CDD:281786 12/45 (27%)
PAW 444..630 CDD:282564 38/229 (17%)
C04E12.5NP_001309618.1 PAW 123..210 CDD:214745 14/62 (23%)
PAW 328..415 CDD:214745 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.