DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pngl and Y47H9A.1

DIOPT Version :9

Sequence 1:NP_610192.1 Gene:Pngl / 35527 FlyBaseID:FBgn0033050 Length:631 Species:Drosophila melanogaster
Sequence 2:NP_492963.1 Gene:Y47H9A.1 / 173047 WormBaseID:WBGene00012945 Length:418 Species:Caenorhabditis elegans


Alignment Length:113 Identity:23/113 - (20%)
Similarity:40/113 - (35%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 RQLNVRYSCATDTYERYAKEGEHITILDSYKTWQKAQFSSKNIFRKVERDWKMAYLARLEDTDCG 541
            |....:|......|....|:|..:           ..|..||:.|..:.:....||.:.:..:.|
 Worm    82 RYFAFKYEIVRGKYSHTNKDGSAV-----------KPFIVKNVERHSDEEPYDVYLQKKKRNEEG 135

  Fly   542 EIAWTFDFSKTN--LKVKSYNLVFETKTF-GDGKISVTVDATDGSASV 586
            .|.|.|:.:.|.  |:.....:|...:|. |.||....:|..:....:
 Worm   136 MIYWKFNLTSTGKVLETLVIRMVGINQTLNGGGKAEACLDTFENCMEI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PnglNP_610192.1 PUB 30..107 CDD:286494
CitX 98..>185 CDD:294885
Transglut_core <278..341 CDD:280085
YebA <282..378 CDD:224224
Rad4 <325..>383 CDD:281786
PAW 444..630 CDD:282564 23/113 (20%)
Y47H9A.1NP_492963.1 PAW 81..165 CDD:214745 19/93 (20%)
PAW 259..346 CDD:214745
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.