DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and AT2G42170

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001323727.1 Gene:AT2G42170 / 818817 AraportID:AT2G42170 Length:329 Species:Arabidopsis thaliana


Alignment Length:332 Identity:252/332 - (75%)
Similarity:292/332 - (87%) Gaps:3/332 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEA 109
            ||||.:.|.:|||:|:::.|||||.||:|||:|:|||||||||:||||:||||||||||||||||
plant     1 MVGMNENDLFVGDDAEARSGILTLDYPMEHGVVSNWDDMEKIWYHTFYSELRVAPEEHPVLLTEA 65

  Fly   110 PLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH 174
            ||||||:||||||||||||..|:||:.:||.|||:|||||||.|||||||||:.||||||.||||
plant    66 PLNPKADREKMTQIMFETFAVPSMYIGMQAALSLHASGRTTGTVLDSGDGVSYIVPIYEGSALPH 130

  Fly   175 AILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK 239
            ||||||||||.||:|||||:.||||   |:||||:||||||:..|:|||:||||..|..||::::
plant   131 AILRLDLAGRHLTNYLMKIMMERGY---TSAEREVVRDIKEQFGYIALDYEQEMEKATKSSAIDR 192

  Fly   240 SYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGT 304
            :||||||||||||.|||||||.|||||.:|||..||||.|||||||||.|||||||.|.||||||
plant   193 TYELPDGQVITIGAERFRCPEVLFQPSLIGMETSGIHEKTYNSIMKCDDDIRKDLYGNIVLSGGT 257

  Fly   305 TMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPS 369
            ||:.||.:||.|||.|||.:.|:|||||||||||||||||||||||||::||||:|.||:|:||:
plant   258 TMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILASLSTYEQMWITKAEYEENGPA 322

  Fly   370 IVHRKCF 376
            |||.|||
plant   323 IVHTKCF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 250/330 (76%)
AT2G42170NP_001323727.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54227
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.