DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and men1

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001016361.1 Gene:men1 / 549115 XenbaseID:XB-GENE-920855 Length:674 Species:Xenopus tropicalis


Alignment Length:187 Identity:38/187 - (20%)
Similarity:64/187 - (34%) Gaps:52/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 IKEKLCYVALD------FEQEMATAASSSSLEKSYELPDGQVI---TIGNERFRCP-ESLFQPSF 267
            :::||.:|..|      :...:...|....|..::..|:...|   .:.:.|.... :.|:...:
 Frog   376 LQQKLLWVLFDGGHLDKYPMALGNLADLEDLAATHGRPNPLEIYHKAVSSSRLHYENQHLYPHIY 440

  Fly   268 LGMEAC---GIHET------------TYNSIMKCDVDIRKDLY--ANTVLSGGTTMYPGIADRMQ 315
            |....|   .|.|.            |||...: |.:|.|||:  ||.:|               
 Frog   441 LAAYHCRNKDIREALKAWAETSAVIQTYNYCRE-DEEIYKDLFDIANDLL--------------- 489

  Fly   316 KEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372
                   |:.:|.:.::|.....|........|:|..|.. .|.|.|.|...| ::|
 Frog   490 -------PNLLKEEAMSPDGPSGSALQDPVCFANLLRFYD-GICKWEEDSPTP-VLH 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 38/187 (20%)
men1NP_001016361.1 Menin 2..672 CDD:282857 38/187 (20%)
Menin 7..561 CDD:271218 38/187 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.