DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and POTEG

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001005356.1 Gene:POTEG / 404785 HGNCID:33896 Length:508 Species:Homo sapiens


Alignment Length:259 Identity:53/259 - (20%)
Similarity:101/259 - (38%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IEHGIVTNWDDM--EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 134
            :|||...|..|.  ....|:..|||.::..:  .:||..|.:..| |:..:|.::..........
Human   226 LEHGTDPNIPDEYGNTALHYAIYNEDKLMAK--ALLLYGADIESK-NKHGLTPLLLGVHEQKQQV 287

  Fly   135 V--AIQAVLSLYASGR--TTGIVLDSGDGVSHTVPIYEGYALPHAIL--RLDLAGRDLTDYLMKI 193
            |  .|:...:|.|..|  .|.::|....|.:..|.:         :|  .:|::.:||:..    
Human   288 VKFLIKKKANLNALDRYGRTALILAVCCGSASIVSL---------LLEQNIDVSSQDLSGQ---- 339

  Fly   194 LTERGYSFTT--TAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF 256
             |.|.|:.::  ....:::.|.|||         |.:..::.:|:.|:..:|...:    .::|.
Human   340 -TAREYAVSSHHNVICQLLSDYKEK---------QMLKVSSENSNPEQDLKLTSEE----ESQRL 390

  Fly   257 RCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITA 320
            :..|: .||..:..|.    |.......|.:.:::|        .|.|.|  |..:.:....||
Human   391 KGSEN-SQPEEMSQEP----EINKGGDRKVEEEMKK--------HGSTHM--GFPENLPNGATA 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 53/259 (20%)
POTEGNP_001005356.1 Ank_4 143..193 CDD:290365
ANK 167..292 CDD:238125 16/68 (24%)
ANK 1 172..201
ANK repeat 174..203 CDD:293786
Ank_2 177..269 CDD:289560 13/45 (29%)
ANK repeat 205..236 CDD:293786 4/9 (44%)
ANK 2 205..234 3/7 (43%)
ANK 233..357 CDD:238125 28/140 (20%)
ANK repeat 238..269 CDD:293786 8/33 (24%)
ANK 3 238..267 7/30 (23%)
Ank_2 243..335 CDD:289560 21/103 (20%)
ANK repeat 271..302 CDD:293786 5/30 (17%)
ANK 4 271..300 4/28 (14%)
ANK repeat 304..335 CDD:293786 6/39 (15%)
ANK 5 304..333 6/37 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..488 17/92 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.