DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and POTEA

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_024302914.1 Gene:POTEA / 340441 HGNCID:33893 Length:559 Species:Homo sapiens


Alignment Length:174 Identity:38/174 - (21%)
Similarity:68/174 - (39%) Gaps:35/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IEHGIVTNWDDM--EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMY 134
            ::||...|..||  ....|:..|||.::..:  .:||..|.:..| |:..:|.::..........
Human   152 LQHGTDPNLPDMYGNTALHYAVYNEDKLMAK--TLLLYGADIESK-NKGGLTPLLLAVHGQKQRM 213

  Fly   135 V--AIQAVLSLYASGR--TTGIVLDSGDGVSHTVPIYEGYALPHAILR--LDLAGRDLTDYLMKI 193
            |  .|:...:|.|..|  .|.::|....|.:..|.:         :|:  :|:..:|:       
Human   214 VKFLIKKKANLNALDRFGRTALILAVRCGSASIVSL---------LLQQNIDVFSQDV------- 262

  Fly   194 LTERGYSFTTTAEREIVRDIKEKLCYVALDF-EQEMATAASSSS 236
                   |..|||...|......:|.:..|: |.:|...:|.:|
Human   263 -------FGQTAEDYAVSSHHSIICQLLSDYKENQMPNNSSGNS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 38/174 (22%)
POTEAXP_024302914.1 ANK 93..218 CDD:238125 16/68 (24%)
ANK repeat 100..129 CDD:293786
ANK repeat 133..162 CDD:293786 3/9 (33%)
ANK 159..283 CDD:238125 31/149 (21%)
ANK repeat 164..195 CDD:293786 8/33 (24%)
ANK repeat 197..228 CDD:293786 5/30 (17%)
ANK repeat 230..261 CDD:293786 6/39 (15%)
SMC_N <302..538 CDD:330553
CCDC144C 452..>559 CDD:317340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.