DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and Arp6

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_511165.1 Gene:Arp6 / 32514 FlyBaseID:FBgn0011741 Length:398 Species:Drosophila melanogaster


Alignment Length:398 Identity:103/398 - (25%)
Similarity:191/398 - (47%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKY- 70
            |.:|:|||:...|.|.|..|.|..| |:.:.:.:.:       ::.::||::....|....|.| 
  Fly     4 AVVVLDNGAHTAKVGLANQDEPHVV-PNCIMKAKSE-------RRRAFVGNQIDECRDTSALYYI 60

  Fly    71 -PIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAM 133
             ..:.|.:.||...:.:|.:.|..: :..:.|...:::||..:|.::.:|...:|:||.:....:
  Fly    61 LAFQRGYLLNWHTQKTVWDYIFSKDGIGCSLENRNIVITEPQMNFQSIQEATLEILFEEYKVDGV 125

  Fly   134 YVAIQAVLSLY-----ASGRTT-----GIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTD 188
            |....|.|:.:     :..|||     .|::|.|...:|.||...|..:...|.|:|:.|:.||:
  Fly   126 YKTTAADLAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTN 190

  Fly   189 YLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEK---SYELPD----- 245
            .|.::::.|  ......|..:|..|||.:|:||.||:|.|....|.....:   .|.|||     
  Fly   191 QLKELISYR--HLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTVK 253

  Fly   246 ----------------GQVITIGNERFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDL 294
                            .|::::.||||..||.||.||.:|::..||.|...:.:..|..:..::|
  Fly   254 RGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPWEAHREL 318

  Fly   295 YANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWIS 359
            ..|.::.||:..:||...|:::::.||.|..:::.::.|.:.....|.||..:|:...|::...:
  Fly   319 LLNILIVGGSAQFPGFLPRLKRDLRALVPDDLEVSLICPEDPVRYAWYGGKEVATSPNFEEFVYT 383

  Fly   360 KQEYDESG 367
            :.:|:|.|
  Fly   384 QDDYEEYG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 103/398 (26%)
Arp6NP_511165.1 ACTIN 3..398 CDD:214592 103/398 (26%)
COG5277 6..391 CDD:227602 101/394 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.