DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and Acte1

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001356763.1 Gene:Acte1 / 102636989 MGIID:2685344 Length:382 Species:Mus musculus


Alignment Length:382 Identity:183/382 - (47%)
Similarity:254/382 - (66%) Gaps:11/382 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRH----------QGVMVGMGQKDSYVGDEA 59
            |...||.|.|||..|.||:|..||:||||:|:|:.:|          |.|:.|:|::|.::|.|.
Mouse     2 EKTPLVCDYGSGFSKVGFSGTQAPQAVFPTILGKMKHTGLSGPACVFQNVLEGLGEQDWFIGAET 66

  Fly    60 QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIM 124
            |:.|..|.:.|||..|.:||||::|||||::||:.|::|||:||:|:|||||..|..:.:||||:
Mouse    67 QTNRTELNMYYPISRGAITNWDNVEKIWHYSFYHSLQIAPEQHPILITEAPLTSKEAKSRMTQIL 131

  Fly   125 FETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDY 189
            |||||.||:|.|.||||||.|||||:|..::||||:::.||:..||.|..:..:||:||:|||.|
Mouse   132 FETFNFPALYTANQAVLSLIASGRTSGTAIESGDGMTYFVPVMNGYPLHLSTTKLDIAGQDLTLY 196

  Fly   190 LMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNE 254
            |||:|::.|....|.|:.|.:||:|:|..|||||:..|| :..|:.|.:|.:.||||:.|.:|.|
Mouse   197 LMKLLSDNGNVLETIADLEYIRDLKDKYSYVALDYNMEM-SKTSAPSFQKKFTLPDGKEINLGQE 260

  Fly   255 RFRCPESLFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT 319
            .|.|.|.||..|.|.....|||..|..|||.|:...::.|:...||:|||:...|:..|||||:.
Mouse   261 AFMCSEVLFDTSLLERANPGIHMLTLESIMSCEKSHQRTLFNYIVLTGGTSACTGLRFRMQKEMA 325

  Fly   320 ALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
            .:......:|:.|.|..|||.|||.|||:||..|:.|||:..||.|.|||::.|:||
Mouse   326 KVVSPDFCVKVTASPYAKYSAWIGASILSSLPLFKDMWITNHEYLEIGPSVIFRRCF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 181/380 (48%)
Acte1NP_001356763.1 NBD_sugar-kinase_HSP70_actin 2..382 CDD:354300 181/380 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.