DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act42A and LOC102552318

DIOPT Version :9

Sequence 1:NP_523625.1 Gene:Act42A / 35526 FlyBaseID:FBgn0000043 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_038957224.1 Gene:LOC102552318 / 102552318 RGDID:7506405 Length:383 Species:Rattus norvegicus


Alignment Length:359 Identity:165/359 - (45%)
Similarity:234/359 - (65%) Gaps:11/359 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PRAVFPSIVGR----------PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDD 82
            |..:.|::..|          |..|.::..:.::|.::|.|.|:.|..|.:.|||..|.:||||:
  Rat    26 PVGLAPALGSRSDSYVQDSLLPFLQTLLERLEEEDWFIGAEVQNNRPKLNIHYPIFRGAITNWDN 90

  Fly    83 MEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASG 147
            ::|:||::||:.||:|||:||:|:|:.||..|..|.|||||:|||||.||:|:|.|.||||||||
  Rat    91 VQKVWHYSFYHYLRIAPEQHPILVTDPPLTTKEARSKMTQILFETFNFPALYLANQGVLSLYASG 155

  Fly   148 RTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRD 212
            ||:|..::||||:::.|||..||.|..:..::|.||:|||.||||:|::.|....|||:.|.|||
  Rat   156 RTSGTTIESGDGMTYFVPIANGYPLHLSTTKVDTAGQDLTVYLMKLLSDNGNMLETTADLEHVRD 220

  Fly   213 IKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMEACGIHE 277
            :|||.||||||::.||:..:.||.|:| :.||||:.|::|.|.|.|||.||.||.:|....||..
  Rat   221 LKEKCCYVALDYDMEMSKTSESSFLKK-FTLPDGKEISLGQETFMCPEVLFNPSLVGKNYPGIDM 284

  Fly   278 TTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWI 342
            ....||..||....::|:...:|||||....|:..|:|:||..|....:.:|:|..|..||..|:
  Rat   285 QAQQSITSCDKSHWRNLFGYIILSGGTGTCSGLRFRLQREIAKLVSPELSVKVVTSPYAKYGAWV 349

  Fly   343 GGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376
            |.|||.||..|:.|||:..||.|.|||::.|:.|
  Rat   350 GASILCSLPMFKDMWITNHEYLEIGPSVICRRTF 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act42ANP_523625.1 PTZ00281 1..376 CDD:173506 164/357 (46%)
LOC102552318XP_038957224.1 NBD_sugar-kinase_HSP70_actin 57..383 CDD:418402 159/326 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 1 1.000 - - FOG0000057
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.