DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and LSB1

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:37/212 - (17%)
Similarity:75/212 - (35%) Gaps:31/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 KNDIYQKYDKYMTYGTIYEILHRKTSQSSDPWQRKSLSSILEGGRSSGDIIYDIGQRRERDKRTL 880
            :|::....:..:..|.|:|:::.|..:..|..||...::..|   ...:.:||...:::.|....
Yeast    14 RNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTE---EYVEALYDFEAQQDGDLSLK 75

  Fly   881 GSSSSATVSTINPHKYGTIYDILQGVKIDAGHVKNKPDQKSKP---------------TKPPLAK 930
            .......:..|:|..|....:...|: ..|.:||....:.:.|               ..||..:
Yeast    76 TGDKIQVLEKISPDWYRGKSNNKIGI-FPANYVKPAFTRSASPKSAEAASSSTVSRPSVPPPSYE 139

  Fly   931 P--TRFVVSQVVEPVQIPPTDQSGKSVQEQGAPKSNKPNKMRRLSNILSYSRNSGEDQQETTGKE 993
            |  :::...||..|...|.........|:|.||....|          .::....:.||:.....
Yeast   140 PAASQYPSQQVSAPYAPPAGYMQAPPPQQQQAPLPYPP----------PFTNYYQQPQQQYAPPS 194

  Fly   994 ETKPKRTQAKRRIGVTN 1010
            :..|...|.::..|.::
Yeast   195 QQAPVEAQPQQSSGASS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233
PTKc_Frk_like 1319..1587 CDD:270653
Pkinase_Tyr 1328..1580 CDD:285015
LSB1NP_011652.1 SH3 55..108 CDD:214620 9/56 (16%)
PRK14971 <100..>156 CDD:237874 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.