DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and AT5G40540

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_198870.1 Gene:AT5G40540 / 834052 AraportID:AT5G40540 Length:353 Species:Arabidopsis thaliana


Alignment Length:291 Identity:91/291 - (31%)
Similarity:140/291 - (48%) Gaps:31/291 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1320 QWEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKD-------FLAEAQIMKK 1377
            :|.:|...|....|:|.|....::||.:.|.| ||||.:|.|. .|::       |..|..::.:
plant    18 KWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKT-VAIKIVKRGE-SPEEIAKRESRFAREVSMLSR 80

  Fly  1378 LRHTKLIQLYAVCTVEEPI-YIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYL 1441
            ::|..|::....|  :||| .|:|||:..|:|.:||.::  :..||.::..:..|..||..|..|
plant    81 VQHKNLVKFIGAC--KEPIMVIVTELLLGGTLRKYLVSL--RPGSLDIRVAVGYALDIARAMECL 141

  Fly  1442 ESQNYIHRDLAARN-VLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTAPEAANYSKFSI 1505
            .|...|||||...: :|..|...||:|||||||  :|...|.........:|.|||.  ||..::
plant   142 HSHGVIHRDLKPESLILTADYKTVKLADFGLAR--EESLTEMMTAETGTYRWMAPEL--YSTVTL 202

  Fly  1506 ----------KSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIML 1560
                      |.|.:||.|:|.||: :.::|:.||:|.:...........|...:....|..|:.
plant   203 RHGEKKHYNHKVDAYSFAIVLWELI-HNKLPFEGMSNLQAAYAAAFKNVRPSADDLPKDLAMIVT 266

  Fly  1561 ECWHKDPMRRPTF-ETLQWKLEDFYTSDQSD 1590
            .||.:||..||.| |.:|..|....|...::
plant   267 SCWKEDPNDRPNFTEIIQMLLRCLSTISSTE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233
PTKc_Frk_like 1319..1587 CDD:270653 91/286 (32%)
Pkinase_Tyr 1328..1580 CDD:285015 87/271 (32%)
AT5G40540NP_198870.1 STKc_MAP3K-like 32..286 CDD:270901 85/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1725
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.