DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and grb2a

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_001007770.1 Gene:grb2a / 493609 ZFINID:ZDB-GENE-041121-1 Length:217 Species:Danio rerio


Alignment Length:123 Identity:38/123 - (30%)
Similarity:59/123 - (47%) Gaps:32/123 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1199 FTRGEF---LNEK---------------------------SWYFRKIKRIEAEKKLLLPENEHGA 1233
            |.|||.   |||:                           .|::.||.|.:|| ::|..:...||
Zfish    19 FKRGEILKVLNEECDQNWYKAELNGKEGFIPKNYIEMKPHPWFYGKIPRAKAE-EMLNKQRHDGA 82

  Fly  1234 FLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDS 1291
            ||||:|||...|:||||:.|:.|:|:::.: |..|.:......|.:|..||:::...|
Zfish    83 FLIRESESAPGDFSLSVKFGNDVQHFKVLR-DGAGKYFLWVVKFNSLNSLVDYHRSTS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 31/82 (38%)
PTKc_Frk_like 1319..1587 CDD:270653
Pkinase_Tyr 1328..1580 CDD:285015
grb2aNP_001007770.1 SH3_GRB2_N 1..56 CDD:212879 7/36 (19%)
SH2_Grb2_like 56..150 CDD:199828 31/86 (36%)
SH3_GRB2_C 160..212 CDD:212882
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.