DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Src42A and grb2b

DIOPT Version :9

Sequence 1:	NP_610191.2	Gene:	Src42A / 35524	FlyBaseID:	FBgn0264959	Length:	1597	Species:	Drosophila melanogaster
Sequence 2:	NP_998200.1	Gene:	grb2b / 406308	ZFINID:	ZDB-GENE-040426-1975	Length:	217	Species:	Danio rerio

Alignment Length:	123	Identity:	39/123 - (31%)
Similarity:	59/123 - (47%)	Gaps:	32/123 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly  1199 FTRGEF---LNEK---------------------------SWYFRKIKRIEAEKKLLLPENEHGA 1233
            |.|||.   |||:                           .|:|.:|.|..|| ::|..:...||
Zfish    19 FKRGEILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPWFFGRIPRARAE-EILNKQRHDGA 82

  Fly  1234 FLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDS 1291
            ||||:|||...|:||||:.|:.|:|:::.: |..|.:......|.:|.|||:::...|
Zfish    83 FLIRESESAPGDFSLSVKFGNDVQHFKVLR-DGAGKYFLWVVKFNSLNELVDYHRTTS 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Src42A	NP_610191.2	SH2_Src_Src42	1210..1301	CDD:198233	32/82 (39%)
		PTKc_Frk_like	1319..1587	CDD:270653
		Pkinase_Tyr	1328..1580	CDD:285015
grb2b	NP_998200.1	SH3_GRB2_N	1..56	CDD:212879	7/36 (19%)
		SH2_Grb2_like	56..150	CDD:199828	32/86 (37%)
		SH3_GRB2_C	160..212	CDD:212882
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000006
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.910