DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and ITK

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_005537.3 Gene:ITK / 3702 HGNCID:6171 Length:620 Species:Homo sapiens


Alignment Length:407 Identity:158/407 - (38%)
Similarity:241/407 - (59%) Gaps:27/407 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1199 FTRGEFLNEKS--------WYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSV----- 1250
            :....:|.|||        ||.:.|.|.:|| ||||...:.|||::|||.:. ..|::||     
Human   220 YVPSSYLVEKSPNNLETYEWYNKSISRDKAE-KLLLDTGKEGAFMVRDSRTA-GTYTVSVFTKAV 282

  Fly  1251 --RDGDTVKHYRIRQLDEG--GFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKP-CVQIEK-PV 1309
              .:...:|||.|::.::.  .:::|.:..|.::..|:.::..:..||...|..| |...:| ||
Human   283 VSENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPV 347

  Fly  1310 TEGLSHRTRDQWEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQI 1374
            |.||.:   .:|.||.:.|.||:::||||||.|..|.|.|...|||||::.|.|..:||:.||::
Human   348 TAGLRY---GKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEV 409

  Fly  1375 MKKLRHTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMA 1439
            |.||.|.||:|||.||..:.||.::.|.|:||.|.:||:...|   ....:||:.|...:..|||
Human   410 MMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRG---LFAAETLLGMCLDVCEGMA 471

  Fly  1440 YLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTAPEAANYSKFS 1504
            |||....|||||||||.|||:..::|::|||:.|.:.:|:|.:..|.:||:||.:||..::|::|
Human   472 YLEEACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYS 536

  Fly  1505 IKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIMLECWHKDPMR 1569
            .||||||||:|:.|:.:.|:|||...:|:||:..:..|:|:.:|......:|:||..||.:.|..
Human   537 SKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPED 601

  Fly  1570 RPTFETLQWKLEDFYTS 1586
            ||.|..|..:|.:...|
Human   602 RPAFSRLLRQLAEIAES 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 29/99 (29%)
PTKc_Frk_like 1319..1587 CDD:270653 117/268 (44%)
Pkinase_Tyr 1328..1580 CDD:285015 112/251 (45%)
ITKNP_005537.3 PH_Btk 7..148 CDD:269944
SH3_ITK 174..229 CDD:212841 1/8 (13%)
SH2_Tec_Itk 232..340 CDD:198259 30/109 (28%)
PTKc_Itk 358..613 CDD:133243 114/257 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.