DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and F39B2.5

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_493574.2 Gene:F39B2.5 / 185487 WormBaseID:WBGene00009556 Length:192 Species:Caenorhabditis elegans


Alignment Length:125 Identity:35/125 - (28%)
Similarity:56/125 - (44%) Gaps:28/125 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1205 LNEKSWYFRKIKRIEAEKKLLL-PENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRI------R 1262
            |.:..||:..:....||:.||| |   .|.||||||.|..:.:::|....|.|.|.|:      |
 Worm    11 LYDCDWYWGDLDWKWAERLLLLCP---IGYFLIRDSRSETHLFTVSYHFQDRVYHSRLSLEDSRR 72

  Fly  1263 QLDEGGFFIARRTTFRTLQELVE--------------HYSK--DSDGLCVNLCKPCVQIE 1306
            .|.....:::|  .:..|.|::|              ||.:  :::...|||.:|..:.|
 Worm    73 NLGSRQPYVSR--DYWNLVEIIERSLEQSLTGQQEMLHYRRGHEAEAARVNLTRPLTKRE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 32/113 (28%)
PTKc_Frk_like 1319..1587 CDD:270653
Pkinase_Tyr 1328..1580 CDD:285015
F39B2.5NP_493574.2 SH2_SOCS7 5..106 CDD:198251 28/99 (28%)
SOCS 126..169 CDD:128549 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.