DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Src42A and sem-5

DIOPT Version :9

Sequence 1:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster
Sequence 2:NP_509342.1 Gene:sem-5 / 181055 WormBaseID:WBGene00004774 Length:228 Species:Caenorhabditis elegans


Alignment Length:176 Identity:49/176 - (27%)
Similarity:69/176 - (39%) Gaps:63/176 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1205 LNEKSWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGF 1269
            :.|.:||..||.|.:||..|..|....|.||:|..||...::|:|||..|:|:|:::.: |:.|.
 Worm    55 MTECNWYLGKITRNDAEVLLKKPTVRDGHFLVRQCESSPGEFSISVRFQDSVQHFKVLR-DQNGK 118

  Fly  1270 FIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQWEIDRT-------- 1326
            :......|.:|.|||.:                            |||.   .:.||        
 Worm   119 YYLWAVKFNSLNELVAY----------------------------HRTA---SVSRTHTILLSDM 152

  Fly  1327 --SLKFVRKL------GSGQF----GDV-----------WEGLWNN 1349
              ..|||:.|      .||:.    |||           |||..||
 Worm   153 NVETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNN 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 29/90 (32%)
PTKc_Frk_like 1319..1587 CDD:270653 16/62 (26%)
Pkinase_Tyr 1328..1580 CDD:285015 14/43 (33%)
sem-5NP_509342.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..151 CDD:199828 35/126 (28%)
SH3_GRB2_like_C 158..210 CDD:212739 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.