DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Src42A and Grap2

DIOPT Version :9

Sequence 1:	NP_610191.2	Gene:	Src42A / 35524	FlyBaseID:	FBgn0264959	Length:	1597	Species:	Drosophila melanogaster
Sequence 2:	NP_001276371.1	Gene:	Grap2 / 17444	MGIID:	1333842	Length:	322	Species:	Mus musculus

Alignment Length:	122	Identity:	37/122 - (30%)
Similarity:	59/122 - (48%)	Gaps:	20/122 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly  1210 WYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGFFIARR 1274
            |:...:.|.:||.  ||...:.|.|:||.|:|...|:|:|||..|.|:|:::.:..:|.:|:...
Mouse    58 WFHEGLSRHQAEN--LLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTE 120

  Fly  1275 TTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQW----EIDRTS 1327
             .|.:|.:||::|...|             |.|.....|...|:||.    .:||.|
Mouse   121 -KFPSLNKLVDYYRTTS-------------ISKQKQVFLRDGTQDQGHRGNSLDRRS 163

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Src42A	NP_610191.2	SH2_Src_Src42	1210..1301	CDD:198233	28/90 (31%)
		PTKc_Frk_like	1319..1587	CDD:270653	5/13 (38%)
		Pkinase_Tyr	1328..1580	CDD:285015	37/122 (30%)
Grap2	NP_001276371.1	SH3	2..53	CDD:302595
		SH2_Grb2_like	54..147	CDD:199828	31/104 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	143..216		7/21 (33%)
		SH3_GRAP2_C	267..319	CDD:212883
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000006
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.910